PDA

View Full Version : Clubdom.com videos



Pages : 1 2 3 4 5 6 7 8 9 [10] 11 12 13 14

Naeite
01-19-2022, 05:30 AM
Clubdom.com- Beg Us To Get Kicked
https://img119.imagetwist.com/th/44666/kfkw1a1vu6e8.jpg (https://imagetwist.com/kfkw1a1vu6e8/cd_05_12_13_ballbusting.jpg)
https://img33.imagetwist.com/th/44666/3xd2dce7194z.jpg (https://imagetwist.com/3xd2dce7194z/cd_05_12_13_ballbusting.mp4.jpg)

Description:
Goddesses Brianna and Cadence are tired of their slave being so disappointing and decide to punish him. Not only are they going to kick him in his pathetic balls, they are going to make him keep begging to be kicked while they do it

Brianna and Cadence take turns kicking and kneeing the slave in the balls, making him beg for more as they laugh at his pain. They kick him from behind, making him guess who is kicking him, then kicking him again for every wrong answer. They finish the bitch off with some full force running kicks, followed by a series of brutal knees to the balls that take the bitch to the ground.
Model:
Cadence Lux, Goddess Brianna
Studio:
Clubdom.com
Info:
File Name : cd_05_12_13_ballbusting.mp4
File Size : 318.68 MB
Resolution : 1280x720
Duration : 00:06:44

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/8b8de325bdffa (https://tezfiles.com/file/8b8de325bdffa)

Naeite
01-19-2022, 05:34 AM
Clubdom.com- Thanks for Obeying but I_m still Caning You
https://img119.imagetwist.com/th/45064/4kp90r0a1uo6.jpg (https://imagetwist.com/4kp90r0a1uo6/cd_s1126_2-4_michellelacy_caning.jpg)
https://img119.imagetwist.com/th/45064/5p2z5xj62id5.jpg (https://imagetwist.com/5p2z5xj62id5/nRRBHpcU.jpg)

Description:
Goddess Michelle Lacy gives her worthless slave a chance to get a light caning by giving very clear directions: if he spills any juice from the orange placed in his mouth, Goddess Michelle will administer a caning of a lifetime. Of course, her pathetic slave can_t follow Goddess Michelle_s simple instructions, and she lives up to her word. She starts caning his pale pathetic ass until it radiates heat.
Model:
Michelle Lacy
Studio:
Clubdom.com
Info:
File Name : cd_s1126_2-4_michellelacy_caning.mp4
File Size : 299.61 MB
Resolution : 1280x720
Duration : 00:06:25

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/597220b077080 (https://tezfiles.com/file/597220b077080)

Naeite
01-19-2022, 05:43 AM
Clubdom.com- Worship Trinity_s Boots
https://img119.imagetwist.com/th/44663/ogrrdd5tm2we.jpg (https://imagetwist.com/ogrrdd5tm2we/cd_04_13_13_bootworship.jpg)
https://img33.imagetwist.com/th/44663/qf0lumdkyn6l.jpg (https://imagetwist.com/qf0lumdkyn6l/cd_04_13_13_bootworship.mp4.jpg)

Description:
Mistress Trinity loves having her boots worshipped by pathetic slaves as she lounges in luxury, watching them humiliate themselves by licking dirt and filth from the bottoms of her boots just hoping to please her. And in case the bitch does not work hard enough to please her, she has his balls locked in a remote controlled electric shocking device that she can activate whenever she wants

Trinity makes sure her bitch licks every bit of the filth from her boots, also making him lick and gag on her gloves as an added bonus.
Model:
Trinity St. Clair
Studio:
Clubdom.com
Info:
File Name : cd_04_13_13_bootworship.mp4
File Size : 73.52 MB
Resolution : 640x360
Duration : 00:07:42

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/36b4d4b385c0d (https://tezfiles.com/file/36b4d4b385c0d)

Naeite
01-19-2022, 05:46 AM
Clubdom.com- Defeated By Esmi_s Dick
https://img119.imagetwist.com/th/44666/nuiuirmtfgy1.jpg (https://imagetwist.com/nuiuirmtfgy1/cd_05_18_13_strapon.jpg)
https://img165.imagetwist.com/th/44666/86267dnzrk50.jpg (https://imagetwist.com/86267dnzrk50/cd_05_18_13_strapon.mp4.jpg)

Description:
After defeating this loser jerk in a wrestling match, Esmi and Amanda have even more punishment and humiliation in store for him. Esmi uses her strapon to violate every last bit of this bitch_s manhood while Amanda amuses herself by making fun of the jerk and making him look at the pussy he will never have.

Amanda gets so aroused by Esmi_s sexual cruelty that she starts making out with Esmi while she is fucking the bitch this loser is being cuckolded while being fucked Esmi finishes the bitch off with a pile driver fuck, then Amanda pulls him by his hair as they take him off to inflict even more humiliation upon his pathetic ass.
Model:
Amanda Tate, Esmi Lee
Studio:
Clubdom.com
Info:
File Name : cd_05_18_13_strapon.mp4
File Size : 316.88 MB
Resolution : 1280x720
Duration : 00:06:44

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/964606e544258 (https://tezfiles.com/file/964606e544258)

Naeite
01-19-2022, 05:49 AM
Clubdom.com- Time To Whip The Bitch
https://img33.imagetwist.com/th/44831/oxkgb9f28wo8.jpg (https://imagetwist.com/oxkgb9f28wo8/s811daisyducatiravenbaywhipthebitch.jpg)
https://img202.imagetwist.com/th/44831/7vlrenblbey4.jpg (https://imagetwist.com/7vlrenblbey4/WYLHOg.jpg)

Description:
Goddess Daisy Ducati and Raven Bay decide it_s time to whip a bitch nothing turns Mistress Raven on more than a slaves suffering and pain, This is what makes her pussy wet she taunts the slut to take more and more whiplashes from Goddess Daisy as he screams for mercy, the ladies are sadistic and give him none.
Model:
Daisy Ducati, Raven Bay
Studio:
Clubdom.com
Info:
File Name : s811daisyducatiravenbaywhipthebitch.mp4
File Size : 340.94 MB
Resolution : 1280x720
Duration : 00:07:08

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/26b3ca14e0f0e (https://tezfiles.com/file/26b3ca14e0f0e)

Naeite
01-19-2022, 05:49 AM
Clubdom.com- Destroying Their Bitches Ass 3 Way Fuck Fest (Strap On)‏
https://img33.imagetwist.com/th/44823/x705jncc3wbz.jpg (https://imagetwist.com/x705jncc3wbz/s576_esmi_natalia_natasha_strap_on.jpg)
https://img69.imagetwist.com/th/44823/qsortam4ku22.jpg (https://imagetwist.com/qsortam4ku22/OcBpOSgT.jpg)

Description:
Goddess Esmi Lee, Natasha Starr and Mistress Natalia Starr decide it_s time to destroy their bitches ass. The ladies are ruthless as they ass pound their pathetic slut. This slave is only there for one thing, their amusement to rigorously ass pound on a daily basis. The ladies all take turns stretching this bitch_s anal cavity to its maximum capacity with their huge 10 inch black strap ons. After Goddess Esmi has given his gaping man pussy all the work it can handle Goddess Natasha flips the bitch over and pounds his gaping man pussy even harder. After completely ruining his fuck hole they sit back stroking their strap ons with their bitch on all fours. Leashed and collard Goddess Esmi makes him sit up, beg, then lay down and roll over obeying every command like a good little bitch. Mistress Natalia says wow and he even know tricks. Just another day on the ClubDom estate.
Model:
Esmi Lee, Natalia Starr, Natasha Starr
Studio:
Clubdom.com
Info:
File Name : s576_esmi_natalia_natasha_strap_on.mp4
File Size : 284.08 MB
Resolution : 1280x720
Duration : 00:06:01

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/1997df99e938d (https://tezfiles.com/file/1997df99e938d)

Naeite
01-19-2022, 05:53 AM
Clubdom.com- Whip The Sissy
https://img202.imagetwist.com/th/45077/9vsuclqk8dbq.jpg (https://imagetwist.com/9vsuclqk8dbq/cd_s1284_nadiawhite_valora_whipping.jpg)
https://img119.imagetwist.com/th/45077/2jjv6oau6nj8.jpg (https://imagetwist.com/2jjv6oau6nj8/vBCEEyjw.jpg)

Description:
Goddess Valora and Mistress Nadia White are going to turn this sissy inside-out with their big cocks. One thing the want to do first is punish him with a nice whipping. The sissy must take what these verbally cruel women dish out or else The women love whipping him. They finish the job with a paddling, each girl swiftly and firmly slapping his ass as he groans. They love it
Model:
Goddess Valora, Nadia White
Studio:
Clubdom.com
Info:
File Name : cd_s1284_nadiawhite_valora_whipping.mp4
File Size : 220.66 MB
Resolution : 1280x720
Duration : 00:04:39

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/9a2386f333799 (https://tezfiles.com/file/9a2386f333799)

Naeite
01-19-2022, 05:56 AM
Clubdom.com- Wank That Cock
https://img119.imagetwist.com/th/44655/p7q8pgm6r5y4.jpg (https://imagetwist.com/p7q8pgm6r5y4/cd_01_12_13_femdompov.jpg)
https://img119.imagetwist.com/th/44655/gr29z1pzkvsa.jpg (https://imagetwist.com/gr29z1pzkvsa/cd_01_12_13_femdompov.mp4.jpg)

Description:
Mistresses Jean, Amaday and Elena are relaxing after a long day of playing with slaves, discussing all the fun things they have done and will be doing, when they notice you and your tiny dick jerking off to them. Well if you are going to do something, you should do it right, so the Mistresses tell you exactly how they want you to jerk off your tiny dick. Will you be able to follow the Mistress_s instructions?
Model:
Elena Sin, Goddess Amadahy, Jean Bardot
Studio:
Clubdom.com
Info:
File Name : cd_01_12_13_femdompov.mp4
File Size : 43.1 MB
Resolution : 640x360
Duration : 00:05:23

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/fb69f2bb73b68 (https://tezfiles.com/file/fb69f2bb73b68)

Naeite
01-19-2022, 05:56 AM
Clubdom.com- Trapped By Sadistic Mistress_s PT 2
https://img165.imagetwist.com/th/44670/az825e4rwpkr.jpg (https://imagetwist.com/az825e4rwpkr/trappedbysadisticmistressspt2.jpg)
https://img202.imagetwist.com/th/44670/i656a7ktz6u6.jpg (https://imagetwist.com/i656a7ktz6u6/trappedbysadisticmistressspt2.mp4.jpg)

Description:
Mistress Mia brings her slave over to Mistress Adrianna. Mistress walks him with a metal leash wrapped around his balls. Mistress Mia has plans for her slave. Mistress Mia_s points her boot at her slave and orders him to take it off because its filthy. Mistress Mia then sticks her sweaty stocking clad foot in the slaves mouth and makes him suck on her toes. Mistress Adrianna smokes a cigarette and has her ass and pussy worshipped as she watch the foot humiliation. Mistress Makes the slave smell her stocking soles as well as gag on them. Mistress Mia later takes off her stockings and feeds them to the slave. The Mistress Mia then lays back and rest her bare feet on the slaves back.
Model:
Adriana, Mistress Mia
Studio:
Clubdom.com
Info:
File Name : trappedbysadisticmistressspt2.mp4
File Size : 213.14 MB
Resolution : 640x360
Duration : 00:09:33

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/2177ac3e33ba5 (https://tezfiles.com/file/2177ac3e33ba5)

Naeite
01-19-2022, 06:01 AM
Clubdom.com- Pleasing Goddess Sheena With Chindo
https://img202.imagetwist.com/th/45180/0hoz9codhypj.jpg (https://imagetwist.com/0hoz9codhypj/cd_s1328_sheenaryder_chindo.jpg)
https://img119.imagetwist.com/th/45180/4mgesqnpwl9t.jpg (https://imagetwist.com/4mgesqnpwl9t/uAyADlu.jpg)

Description:
Goddess Sheena has her slave kneeling before her, verbally abusing and teasing him. Tormenting him with her pussy, forcing him to smell it, to put his face close to it, and reminding him how he will never have pussy. Hes just a pathetic slave and this is the closest he will ever come to having pussy. Goddess Sheena wants to be pleased and the only way this pathetic bitch will please her is with a chindo. He has to wear a dildo on his face, gripping it with his teeth. She makes him fuck her with the chindo, and she gets extremely excited by the chindo. Goddess Sheena enjoys it very much, she tries it from multiple positions, and screams with ecstasy.
Model:
Sheena Ryder
Studio:
Clubdom.com
Info:
File Name : cd_s1328_sheenaryder_chindo.mp4
File Size : 284.24 MB
Resolution : 1280x720
Duration : 00:05:59

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/191e20b29b341 (https://tezfiles.com/file/191e20b29b341)

Naeite
01-19-2022, 06:05 AM
Clubdom.com- Working Their Ponies
https://img202.imagetwist.com/th/44667/ph36mc2ms6o4.jpg (https://imagetwist.com/ph36mc2ms6o4/cd_05_25_13__play.jpg)
https://img33.imagetwist.com/th/44667/74mpgvw9vmij.jpg (https://imagetwist.com/74mpgvw9vmij/cd_05_25_13__play.mp4.jpg)

Description:
Mistresses Elena and Adriana love to use stable bitches as their human ponies. These Mistresses are very demanding and expect their ponies to be in the best of shape, and these two do not meet their expectations, giving out from exhaustion way too quickly.

The Mistresses remind the bitches of what they are supposed to be, making them whinny and neigh, then order them to grovel at their boots in appreciation. After making the bitches run around them in a circle to display their pony skills, the Mistresses take off for another ride, warning their ponies that they will be severely punished if they do not do a better job.
Model:
Adriana, Elena Sin
Studio:
Clubdom.com
Info:
File Name : cd_05_25_13_ponyplay.mp4
File Size : 59.29 MB
Resolution : 640x360
Duration : 00:06:20

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/32dfda47703b4 (https://tezfiles.com/file/32dfda47703b4)

Naeite
01-19-2022, 06:19 AM
Clubdom.com- Michelle, Tangent Rikki: Smothered and Milked
https://img202.imagetwist.com/th/45046/3ke2lnsi93du.jpg (https://imagetwist.com/3ke2lnsi93du/s943michelletangentrikkirumorhandjob.jpg)
https://img119.imagetwist.com/th/45046/ojh648vx9jm1.jpg (https://imagetwist.com/ojh648vx9jm1/lbqAfzn.jpg)

Description:
Mistress Ricky is stroking the slave_s hard cock. He must be so lucky to be out of chastity, except he knows his permission to cum will come at a price. The Mistresses are cruel and won_t ever let any slave have pleasure unless their sadistic torments follow. Mistress Michelle Lacy and Goddess Tangent provoke the slave and tease and smother him with their leather gloved hands and arms until his breath is taken away over and over again. The slave finally cums, but Mistress Ricky feeds it to him. She is learning how to be a cruel Mistress after all here at Clubdom.
Model:
Goddess Tangent, Michelle Lacy, Rikki Rumor
Studio:
Clubdom.com
Info:
File Name : s943michelletangentrikkirumorhandjob.mp4
File Size : 490.4 MB
Resolution : 1280x720
Duration : 00:09:01

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/b84073d294031 (https://tezfiles.com/file/b84073d294031)

Naeite
01-19-2022, 06:26 AM
Clubdom.com- Shocking Ass Cleaning
https://img202.imagetwist.com/th/44720/bup70xz5kn4a.jpg (https://imagetwist.com/bup70xz5kn4a/shockingasscleaning.jpg)
https://img119.imagetwist.com/th/44720/wkp201b0nkoa.jpg (https://imagetwist.com/wkp201b0nkoa/shockingasscleaning.mp4.jpg)

Description:
The Mistress_s are ready to play with there slave. The Mistress_s force the slave out of his kennel and make him crawl around while they shock him with a cattle prod. The Mistress want there asses cleaned and the slave will be using his tongue to Mistress Esmi_s and Mistress Calypso_s perfect asses. The Mistress bend over and first make the little slut smell there essences_. The Mistress make the slave get deep in there ass_s when then slave does not do what the Mistress_s say he gets shocked The pathetic bottom feeder lick up and down his Mistress_s ass_s till they tell him he is done. The Mistress are only somewhat pleased with his licking skills and force so they put him back on his knees and give him some shocks.
Model:
Callie Calypso, Esmi Lee
Studio:
Clubdom.com
Info:
File Name : shockingasscleaning.mp4
File Size : 243.89 MB
Resolution : 640x360
Duration : 00:07:55

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/ecbc1807fc96d (https://tezfiles.com/file/ecbc1807fc96d)

Naeite
01-19-2022, 06:33 AM
Clubdom.com- Losers Take Cock In The Ass
https://img119.imagetwist.com/th/44654/mdlzcza2mply.jpg (https://imagetwist.com/mdlzcza2mply/cd_12_31_12_strapon.jpg)
https://img33.imagetwist.com/th/44654/m52pkr3bv780.jpg (https://imagetwist.com/m52pkr3bv780/cd_12_31_12_strapon.mp4.jpg)

Description:
Mistress Elena knows that you are nothing but a loser who craves her huge cock in your ass, but you do not deserve even that - not without suffering, anyway. Elena makes her pathetic bitch gag on her cock until drool is pouring out his mouth and she is laughing at his gagging.

Once her cock is wet enough, Elena pounds her slave_s ass with it, making him scream out in pain as she rips his asshole open. But Elena has even more in store for the bitch, as she locks him onto his back and pile drives his ass, mercilessly bending him like a pretzel. When Elena has finished fucking him, she tears into him, humiliating him for being a cock craving faggot as she strokes her dick, laughing at the power she has over him.
Model:
Elena Sin
Studio:
Clubdom.com
Info:
File Name : cd_12_31_12_strapon.mp4
File Size : 53.26 MB
Resolution : 640x360
Duration : 00:06:44

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/c14d7bf977bd0 (https://tezfiles.com/file/c14d7bf977bd0)

Naeite
01-19-2022, 06:48 AM
Clubdom.com- Brutal Immobiile Caning By the Guardesses
https://img119.imagetwist.com/th/45047/fjsoitfl2tlz.jpg (https://imagetwist.com/fjsoitfl2tlz/cd_s959_lynnpops_jeanbartdot_lydiasupremacy_caning .jpg)
https://img202.imagetwist.com/th/45047/8504jgzk6rnm.jpg (https://imagetwist.com/8504jgzk6rnm/RAzRJKI.jpg)

Description:
Jean Bardot and Natalya Sadici have their slave in a stockade, ass is out, immobilized and scared. They grin and begin to cane their clean slate of man flesh that is ready to be marked up. Paris looks on at the two skilled Mistresses, taking it all in, getting wet as she is turned on by their sadism and the cries of the slave. MORE, she thinks to herself, as the women keep brutalizing his ass with their canes, giving him such deep welts and stripes. That is what they do here at the estate, every slave needs his routine beating for the enjoyment of the Guardesses and must learn that they are merely flesh for the women to abuse. Captives. Unable to escape the searing pain as the women continue to strike.
Model:
Jean Bardot, Lydia Supremacy
Studio:
Clubdom.com
Info:
File Name : cd_s959_lynnpops_jeanbartdot_lydiasupremacy_caning .mp4
File Size : 375.31 MB
Resolution : 1280x720
Duration : 00:07:54

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/51fdfad96b6ca (https://tezfiles.com/file/51fdfad96b6ca)

Naeite
01-19-2022, 06:58 AM
Clubdom.com- Michelle Natalya Strapon Fuck
https://img165.imagetwist.com/th/44825/1toqb1m0qpqo.jpg (https://imagetwist.com/1toqb1m0qpqo/s648michellelacynatalyasadici.jpg)
https://img33.imagetwist.com/th/44825/1e6hunru30b3.jpg (https://imagetwist.com/1e6hunru30b3/rcutwV.jpg)

Description:
Michelle Lacy and Natalya Sadici have their slave bound at the elbows and knees, making him unable to run away, merely crawl like an animal. Natalya has the cattle prod and both women stroke their strap-on cocks. They shock him and watch him try to run away, but he doesn_t get very far bound up like that. He gives up and gives in to getting fucked by Michelle with Natalya threatening him with the cattle prod.
Model:
Michelle Lacy, Natalya Sadici
Studio:
Clubdom.com
Info:
File Name : s648michellelacynatalyasadici.mp4
File Size : 278.85 MB
Resolution : 1280x720
Duration : 00:05:56

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/be6bb8d0cfe45 (https://tezfiles.com/file/be6bb8d0cfe45)

Naeite
01-19-2022, 06:59 AM
Clubdom.com- The Reluctant Whore 2
https://img202.imagetwist.com/th/45182/4gzw8buwmbdv.jpg (https://imagetwist.com/4gzw8buwmbdv/movie85cfs.jpg)
https://img202.imagetwist.com/th/45182/1yi0juh9lve0.jpg (https://imagetwist.com/1yi0juh9lve0/TZZkZpqe.jpg)

Description:
Club Dom features famous Mistresses from around the world engaging in slave training, corporal punishment, ball-busting, CBT, strap-on, and more.
Model:
Teens girls, beautiful girl, milf
Studio:
Clubdom.com
Info:
File Name : movie85cfs.mp4
File Size : 83.08 MB
Resolution : 640x480
Duration : 00:07:09

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/6a60e3273ec44 (https://tezfiles.com/file/6a60e3273ec44)

Naeite
01-19-2022, 07:03 AM
Clubdom.com- Michelle Lacy Brianna Milking Bitch
https://img33.imagetwist.com/th/44823/2hnn78defbiu.jpg (https://imagetwist.com/2hnn78defbiu/s584_michelle_lacy_brianna_milking_bitch.jpg)
https://img202.imagetwist.com/th/44823/07tpv0j733mr.jpg (https://imagetwist.com/07tpv0j733mr/YPIxCSAv.jpg)

Description:
It_s time to milk another bitch Goddess Brianna and Mistress Michelle Lacy decide it_s time to pull the man filth right out of this slut. He_s looking weak, like he_s lacking protein. Goddess Brianna edges him right to the brink of insanity driving him crazy. Slowly stroking his cock. Stroking it really fast then letting go. The ladies are amused and laugh at his suffering. Making him beg for it. Finally Brianna says you_re going to have to work for it bitch. That_s it fuck my hand, fuck it. You do the work bitch Disgusting filth starts squirting out of his slut stick. Squirt after squirt. This bitch will be eating well tonight.
Model:
Goddess Brianna, Michelle Lacy
Studio:
Clubdom.com
Info:
File Name : s584_michelle_lacy_brianna_milking_bitch.mp4
File Size : 331.64 MB
Resolution : 1280x720
Duration : 00:07:01

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/a873a7c6e8d0b (https://tezfiles.com/file/a873a7c6e8d0b)

Naeite
01-19-2022, 07:07 AM
Clubdom.com- Chastity Teasing by Hailey
https://img119.imagetwist.com/th/45074/scmt0nrv02qd.jpg (https://imagetwist.com/scmt0nrv02qd/cd_s68_chastity_tease.jpg)
https://img119.imagetwist.com/th/45074/jd9wpyzc4bzc.jpg (https://imagetwist.com/jd9wpyzc4bzc/YPLuJZw.jpg)

Description:
Never Release
Model:
Hailey Young
Studio:
Clubdom.com
Info:
File Name : cd_s68_chastity_tease.mp4
File Size : 276.38 MB
Resolution : 1280x720
Duration : 00:05:50

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/872fd3611f68b (https://tezfiles.com/file/872fd3611f68b)

Naeite
01-19-2022, 07:12 AM
Clubdom.com- Harlow Harrison Boot Worship
https://img119.imagetwist.com/th/45054/ao3fgjzrf9vi.jpg (https://imagetwist.com/ao3fgjzrf9vi/cd_s1105_harlowharrison_boot.jpg)
https://img202.imagetwist.com/th/45054/vtgevpuncy65.jpg (https://imagetwist.com/vtgevpuncy65/zCAEih.jpg)

Description:
Goddess Harlow Harrison loves wearing her thigh high latex boots. Her pathetic slave can only get hard when he fucks her boots. Goddess Harlow makes her slave worship her shiny boots with his tongue. After he licks her boots up and down, her jerks off his slut stick all over Goddess Harlow_s boots which she forces him to clean up with his mouth.
Model:
Harlow Harrison
Studio:
Clubdom.com
Info:
File Name : cd_s1105_harlowharrison_boot.mp4
File Size : 310.12 MB
Resolution : 1280x720
Duration : 00:06:34

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/1a42a7d3bee7c (https://tezfiles.com/file/1a42a7d3bee7c)

Naeite
01-19-2022, 07:14 AM
Clubdom.com- A Bitch for FemDom Part 3
https://img69.imagetwist.com/th/44821/385av3fg8xpn.jpg (https://imagetwist.com/385av3fg8xpn/s502_minimovie_jean_bardot_michelle_lacy_part3.jpg )
https://img119.imagetwist.com/th/44821/e8be1lc5d126.jpg (https://imagetwist.com/e8be1lc5d126/UPhscgY.jpg)

Description:
Michelle Lacy and Jean Bardot Teach their new male bitch pony etiquette as he pulls them around in the pony cart, After a few hundred jumping jacks and push ups , some cbt, whipping now its time for a proper caning . Jean and Michelle are delighted in pulling yet another FemDom bitch out of denial (Pt. 3 of A Bitch for FemDom).
Model:
Jean Bardot, Michelle Lacy
Studio:
Clubdom.com
Info:
File Name : s502_minimovie_jean_bardot_michelle_lacy_part3.mp4
File Size : 342.17 MB
Resolution : 1280x720
Duration : 00:07:13

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/553e0d5ae011e (https://tezfiles.com/file/553e0d5ae011e)

Naeite
01-19-2022, 07:17 AM
Clubdom.com- Dahila Rain Alexis Grace: Ass-Licking Loser
https://img202.imagetwist.com/th/45050/0fi66gfewvao.jpg (https://imagetwist.com/0fi66gfewvao/cd_s1014_dahilarain_alexisgrace_assworship.jpg)
https://img202.imagetwist.com/th/45050/z5swoeqtiz3b.jpg (https://imagetwist.com/z5swoeqtiz3b/NnFffdoZ.jpg)

Description:
Goddess Alexis has a slave to lick her and Mistress Dahlia Rain_s asses. He is shoved into Goddess Alexis_s ass first by Dahlia, and he must lick only her beautiful perfect asshole as he is a loser and not worthy of her pussy. Bossed around and told to stick out his tongue and lick it good, this is all he is good for. Next Goddess Alexis Grace demands that he stare at Dahlia_s perfect ass in between licking it, seeing how lucky he is of the privilege.
Model:
Alexis Grace, Dahlia Rain
Studio:
Clubdom.com
Info:
File Name : cd_s1014_dahilarain_alexisgrace_assworship.mp4
File Size : 267.75 MB
Resolution : 1280x720
Duration : 00:05:46

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/4f97bba2dd508 (https://tezfiles.com/file/4f97bba2dd508)

Naeite
01-19-2022, 07:19 AM
Clubdom.com- Beg For Your Dinner
https://img165.imagetwist.com/th/44653/2sjvimw056sp.jpg (https://imagetwist.com/2sjvimw056sp/cd_scene_12_08_12_milking.jpg)
https://img33.imagetwist.com/th/44653/3hq8va1oven5.jpg (https://imagetwist.com/3hq8va1oven5/cd_scene_12_08_12_milking.mp4.jpg)

Description:
Goddesses Brianna and Jamie have had their slave locked in the stocks and starving for days. The Goddesses are merciful and decide to feed him, but only if he makes his own dinner - by cumming

The Goddesses expertly milk the slave_s cock with their hands, all the while making him beg to cum. When they finally allow him to cum in a glass, they make sure he eats every last drop of his filth.
Model:
Goddess Brianna, Jamie Valentine
Studio:
Clubdom.com
Info:
File Name : cd_scene_12_08_12_milking.mp4
File Size : 50.89 MB
Resolution : 640x360
Duration : 00:06:26

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/7d3144f68ddbe (https://tezfiles.com/file/7d3144f68ddbe)

Naeite
01-19-2022, 07:19 AM
Clubdom.com- Fuck My Boy Pussy
https://img202.imagetwist.com/th/45063/gxq3gxdzx8g8.jpg (https://imagetwist.com/gxq3gxdzx8g8/cd_s769_full_annalee_brat.jpg)
https://img119.imagetwist.com/th/45063/x20fsmcps3y3.jpg (https://imagetwist.com/x20fsmcps3y3/xLDkaZ.jpg)

Description:
Goddess Anna Lee is enjoying her cigarette while she sits above her slave_s quarters. While this worthless slave tries to look up at her through his cage bars, Goddess Anna makes him beg her to fuck his boy pussy while she blows smoke in his face. Then informs this pathetic bitch that he must first please his Goddess and lets him out. Once her slave is unlocked and on his knees she straps a chindo to his fuck hole and instructs him that he better please her or else. Bratty Dom Anna Lee is using her pathetic fuck boy for her own amusement, she has made him already fuck her young wet pussy with a chindo, and he failed to make her cum, So now she has dragged him out of his cage and straddles his chest and makes him watch closeup as she masturbates with her big black vibrator, Letting him taste her nectar as she shoves it in his mouth after she has reached orgasm, Then tells him that_s how it_s done now beg me to fuck your boy pussy Bratty Dom Anna Lee has had to satisfy herself And now is strapped up with a thick 10 inch cock and ready to spread and gape some boy pussy. Bratty Dom Anna makes her slut puppy suck and deep throat her hard cock, Gagging and spitting all over it as she makes him beg her to Fuck his boy pussy She smacks his face and bends him over the fucking horse and spreads that tight little boy cunt and rams and fucks him hard.
Model:
Anna Lee
Studio:
Clubdom.com
Info:
File Name : cd_s769_full_annalee_brat.mp4
File Size : 856.08 MB
Resolution : 1280x720
Duration : 00:18:03

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/27d1cf89212e4 (https://tezfiles.com/file/27d1cf89212e4)

Naeite
01-19-2022, 07:29 AM
Clubdom.com- Punching Ball-Sac
https://img202.imagetwist.com/th/45168/7jgix7o7co82.jpg (https://imagetwist.com/7jgix7o7co82/EfDbdEn.jpg)
https://img119.imagetwist.com/th/45168/bq09o4p3xjxm.jpg (https://imagetwist.com/bq09o4p3xjxm/OYSUQVG.jpg)

Description:
Lady Cheyenne crops a slave_s cock while he is made to swing weights.
Model:
Teens girls, beautiful girl, milf
Studio:
Clubdom.com
Info:
File Name : Movie316.wmv
File Size : 17.48 MB
Resolution : 320x240
Duration : 00:04:43

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/e8be4b2f15b55 (https://tezfiles.com/file/e8be4b2f15b55)

Naeite
01-19-2022, 07:30 AM
Clubdom.com- Pool Boys Balls get Busted
https://img202.imagetwist.com/th/45056/d0uxivz8owup.jpg (https://imagetwist.com/d0uxivz8owup/cd_s506_cheyenne_jewel_amadahy_bb_lift_carry.jpg)
https://img119.imagetwist.com/th/45056/issfasg2ch73.jpg (https://imagetwist.com/issfasg2ch73/AdrvPWO.jpg)

Description:
The pool boy is at the estate cleaning the pool. As the mistresses walk past they hear him make an inappropriate comment about what nice asses they have. Snide remarks like that deserve a lesson. Amadahy quickly pulls his pants down and grabs his balls showing him she_s in control and that she owns him. Cheyenne Jewel then flips him up around her shoulders and carries him out to the field. Cheyenne holds him steady as Amadahy proceeds to jump kick him right in the nuts. Ball busting at its best Over and over, kick after kick, she wins as he stumbles to the ground. With victory they sit on top of him and scoop up his pathetic slut sacks as a reminder of who owns men
Model:
Cheyenne Jewel, Goddess Amadahy
Studio:
Clubdom.com
Info:
File Name : cd_s506_cheyenne_jewel_amadahy_bb_lift_carry.mp4
File Size : 244.81 MB
Resolution : 1280x720
Duration : 00:05:15

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/2d73ab5647096 (https://tezfiles.com/file/2d73ab5647096)

Naeite
01-19-2022, 07:32 AM
Clubdom.com- Bull Whipping
https://img202.imagetwist.com/th/45169/sap2tfhiwhkf.jpg (https://imagetwist.com/sap2tfhiwhkf/SlIHhHJB.jpg)
https://img202.imagetwist.com/th/45169/shbkmlnv2b8e.jpg (https://imagetwist.com/shbkmlnv2b8e/PSXRgy.jpg)

Description:
Club Dom features famous Mistresses from around the world engaging in slave training, corporal punishment, ball-busting, CBT, strap-on, and more.
Model:
Teens girls, beautiful girl, milf
Studio:
Clubdom.com
Info:
File Name : Movie344.wmv
File Size : 7.49 MB
Resolution : 320x240
Duration : 00:02:00

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/9872182363a6f (https://tezfiles.com/file/9872182363a6f)

Naeite
01-19-2022, 07:45 AM
Clubdom.com- Michelle Lacy Natalya POV
https://img202.imagetwist.com/th/44825/95f4x1pmvaqe.jpg (https://imagetwist.com/95f4x1pmvaqe/s645michellelacynatalyasadicipov02.jpg)
https://img202.imagetwist.com/th/44825/ck3788ormpso.jpg (https://imagetwist.com/ck3788ormpso/rVzfQL.jpg)

Description:
Mistress Michelle Lacy and Natalya Sadici laugh at the pathetic slave as he stares at their shiny black outfits and sexy shoes wishing he could touch hid pathetic 2 inch slut stick. The ladies first instruct him to smack himself in the balls hard at least 10 times. Then he must take three fingers and shove them up his pathetic asshole. When he_s drooled enough on the floor they give him permission to jerk his 2 inch dicklet. Finally, the countdown begins, 5-4-3-2-1... The slave releases his man filth onto the floor and he is demanded to lick up every last drop of his own disgusting white goo.
Model:
Michelle Lacy, Natalya Sadici
Studio:
Clubdom.com
Info:
File Name : s645michellelacynatalyasadicipov02.mp4
File Size : 279.68 MB
Resolution : 1280x720
Duration : 00:05:56

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/b743c0e0ce0c4 (https://tezfiles.com/file/b743c0e0ce0c4)

Naeite
01-19-2022, 07:47 AM
Clubdom.com- Rikki Rumor Jade Whipping
https://img119.imagetwist.com/th/45048/ejzah0unfjwa.jpg (https://imagetwist.com/ejzah0unfjwa/cd_s935_rikkirumor_jadejantzen_whipping.jpg)
https://img202.imagetwist.com/th/45048/q2xne6ypxhas.jpg (https://imagetwist.com/q2xne6ypxhas/cFsQCBh.jpg)

Description:
Rikki Rumor &amp Jade Whipping
Model:
Jade Jantzen, Rikki Rumor
Studio:
Clubdom.com
Info:
File Name : cd_s935_rikkirumor_jadejantzen_whipping.mp4
File Size : 392.05 MB
Resolution : 1280x720
Duration : 00:08:20

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/0eb301078e864 (https://tezfiles.com/file/0eb301078e864)

Naeite
01-19-2022, 07:47 AM
Clubdom.com- Lydia Kylie Rogue StrapOn POV
https://img69.imagetwist.com/th/44835/u3n7ih8g847c.jpg (https://imagetwist.com/u3n7ih8g847c/s841lydiasupremacykylieroguestraponpov.jpg)
https://img165.imagetwist.com/th/44835/0z5ujy9tcwmg.jpg (https://imagetwist.com/0z5ujy9tcwmg/EzuEAQ.jpg)

Description:
Crawl over and lick our cocks, we see you panting for it. Your ass is going to be a dick cozey for us today, get ready to be stretched and start touching yourself. keep stroking while we show you how to open wide that slutty mouth to wrap those lips around both our cocks. Don_t stop fingering that manpussy Lydia Supremacy shows you what it would be like to be skull fucked by her and Kylie Rogue shows you what it would be like to fuck your other sluthole, spit roasting you
Model:
Kylie Rogue, Lydia Supremacy
Studio:
Clubdom.com
Info:
File Name : s841lydiasupremacykylieroguestraponpov.mp4
File Size : 257.88 MB
Resolution : 1280x720
Duration : 00:05:28

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/443271efb6e30 (https://tezfiles.com/file/443271efb6e30)

Naeite
01-19-2022, 07:55 AM
Clubdom.com- Kitty and Valora Break Their Slave: Pussy Tease
https://img202.imagetwist.com/th/45183/vifc775feak9.jpg (https://imagetwist.com/vifc775feak9/cd_s1353_valora_kitty_pussytease.jpg)
https://img119.imagetwist.com/th/45183/wsx0c5onoazk.jpg (https://imagetwist.com/wsx0c5onoazk/xXbcPA.jpg)

Description:
Goddess Valora and Mistress Kitty have their new slave locked up in a cage in the torture room. They decide that today they are going to break their bitch slave sexually. Mistress Kitty is so excited to have a new weak little play toy for the day Goddess Valora makes the slave beg to be released from his cage. They let the pathetic bitch out of its cage and the girls decide to give the slut a little lesson in tease and denial. Kitty plays with her pussy while Goddess Valora forces the helpless slaves face between Kittys legs for a close-up view. Kitty uses her pink vibrator to please herself, rubbing it on her clit and pussy. The slave has to keep his hands behind his back as Goddess Valora takes control of the vibrator while Kitty rubs her clit. Mistress Kitty screams in delight as she orgasms and cums with her bitch watching but not allowed to touch her or even himself The Ladies decide they are not done with this bitch yet, his humiliation is just beginning.
Model:
Goddess Valora, Kitty Carrera
Studio:
Clubdom.com
Info:
File Name : cd_s1353_valora_kitty_pussytease.mp4
File Size : 307.28 MB
Resolution : 1280x720
Duration : 00:06:30

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/f98a92a10b9e3 (https://tezfiles.com/file/f98a92a10b9e3)

Naeite
01-19-2022, 07:58 AM
Clubdom.com- His Balls Being Caned Part 3
https://img119.imagetwist.com/th/45169/mp5td8yqvtd6.jpg (https://imagetwist.com/mp5td8yqvtd6/jJRmdXXW.jpg)
https://img202.imagetwist.com/th/45169/wsldy922tuxu.jpg (https://imagetwist.com/wsldy922tuxu/hdVqAuH.jpg)

Description:
Club Dom features famous Mistresses from around the world engaging in slave training, corporal punishment, ball-busting, CBT, strap-on, and more.
Model:
Teens girls, beautiful girl, milf
Studio:
Clubdom.com
Info:
File Name : Movie335c.wmv
File Size : 8.61 MB
Resolution : 320x240
Duration : 00:02:19

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/ed34cb5c779ec (https://tezfiles.com/file/ed34cb5c779ec)

Naeite
01-19-2022, 07:59 AM
Clubdom.com- Kylie Rogue POV
https://img165.imagetwist.com/th/44825/bae4u6cq59tn.jpg (https://imagetwist.com/bae4u6cq59tn/s708venuskyliepov1.jpg)
https://img165.imagetwist.com/th/44825/b18o16f7nfi7.jpg (https://imagetwist.com/b18o16f7nfi7/BNmmRQ.jpg)

Description:
Goddess Kylie commands you how to stroke your pitiful little cock to please and entertain her.
Model:
Kylie Rogue
Studio:
Clubdom.com
Info:
File Name : s708venuskyliepov1.mp4
File Size : 350.09 MB
Resolution : 1280x720
Duration : 00:07:24

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/95f21a3a51a0e (https://tezfiles.com/file/95f21a3a51a0e)

Naeite
01-19-2022, 08:02 AM
Clubdom.com- Mistress_s Cum Slut
https://img119.imagetwist.com/th/45077/3pdauvt794nr.jpg (https://imagetwist.com/3pdauvt794nr/cd_s1254_kendrajames_hadleyvascara_pov.jpg)
https://img119.imagetwist.com/th/45077/f6nheyo2u932.jpg (https://imagetwist.com/f6nheyo2u932/Frdaog.jpg)

Description:
Kendra James and Hadley Vascara know that you are craving to be their slave and you would do whatever it takes. You have that chance right now. Get on your knees and do as they say. Stroke that cock and show them how weak you are for them. Show them how much you turn them on. Keep going bitch. DO every humiliating thing they tell you to do. They control you
Model:
Hadley Viscara, Kendra James
Studio:
Clubdom.com
Info:
File Name : cd_s1254_kendrajames_hadleyvascara_pov.mp4
File Size : 231.09 MB
Resolution : 1280x720
Duration : 00:04:52

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/3fc53297a8ed9 (https://tezfiles.com/file/3fc53297a8ed9)

Naeite
01-19-2022, 08:08 AM
Clubdom.com- The Mistress_s New Pet
https://img202.imagetwist.com/th/44714/jpx4c15r5p9x.jpg (https://imagetwist.com/jpx4c15r5p9x/themistresssnewpet.jpg)
https://img202.imagetwist.com/th/44714/yqbm4gqrc3rz.jpg (https://imagetwist.com/yqbm4gqrc3rz/themistresssnewpet.mp4.jpg)

Description:
Mistress Michelle and Mistress Coral have turned there slave into a and have him locked up in a kennel. The Mistress_s have turned them into there pet and will him do the most humiliating things they can think of. The slave will also get a rough pounding in his man pussy. The slave is nothing but a pathetic and the Mistress_s make sure to let him know how he will serve them.
Model:
Coral, Michelle Lacy
Studio:
Clubdom.com
Info:
File Name : themistresssnewpet.mp4
File Size : 142.53 MB
Resolution : 640x360
Duration : 00:06:18

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/f66fb50113fe6 (https://tezfiles.com/file/f66fb50113fe6)

Naeite
01-19-2022, 08:15 AM
Clubdom.com- Natalia Paris Foot Worship
https://img119.imagetwist.com/th/45042/sk54s2mxu7hm.jpg (https://imagetwist.com/sk54s2mxu7hm/s911nataliaparismichellelacyfootworship.jpg)
https://img119.imagetwist.com/th/45042/q1hcqvmbgb3p.jpg (https://imagetwist.com/q1hcqvmbgb3p/KnljfszL.jpg)

Description:
Goddesses Natalia and Paris enjoy sunbathing while drpgd in their furs, their slave worshiping their feet as they relax. When their bitch does not show enough enthusiasm, they spank his ass to give him even more incentive.
Model:
Natalia Starr, Paris Knight
Studio:
Clubdom.com
Info:
File Name : s911nataliaparismichellelacyfootworship.mp4
File Size : 217.44 MB
Resolution : 1280x720
Duration : 00:04:44

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/d525d889f4d05 (https://tezfiles.com/file/d525d889f4d05)

Naeite
01-19-2022, 08:19 AM
Clubdom.com- Sadistic FemDom Caning
https://img202.imagetwist.com/th/45176/ky6h5o2mr6za.jpg (https://imagetwist.com/ky6h5o2mr6za/movie235cfs.jpg)
https://img119.imagetwist.com/th/45176/yyrs7twhf4a6.jpg (https://imagetwist.com/yyrs7twhf4a6/KfyyVb.jpg)

Description:
Lady Cheyenne and Mistress Trish strap their slave down for a good caning. Although the slave cannot move his torso or legs, his hands are left free. The ladies intention is to teach the slave to hold still for a solid caning. The Mistresses proceed to cane their slave with long hard strokes. Instant red and purple welts appear. The slave begins to cover his ass with his hands. Cheyenne will have none of that. She grabs the slave_s arm and twists over his head it as Trish continues to deliver long, cruel cane strokes. Finally, Cheyenne laughs, Go ahead and cover your ass if you can_t help it. As the harsh cane strokes continue, the slave uses his hands to protect his ass. Cheyenne canes his hands, welting his knuckles and palms. Then the ladies light cigarettes. Taking long slow, drags from their cigarettes, they continue to blister their slave_s ass. Cheyenne and Trish are thoroughly enjoying themselves. When they_ve finally had enough they put their red hot cigarette butts out on the slave_s bruised and aching ass. Lady Cheyenne and Mistress Trish simply glow in this extremely sadistic video.
Model:
Teens girls, beautiful girl, milf
Studio:
Clubdom.com
Info:
File Name : movie235cfs.mp4
File Size : 48.67 MB
Resolution : 640x480
Duration : 00:04:11

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/09aa120011bee (https://tezfiles.com/file/09aa120011bee)

Naeite
01-19-2022, 08:23 AM
Clubdom.com- The Loser Is Whipped To Shreds
https://img119.imagetwist.com/th/44718/esohvp0i4jvn.jpg (https://imagetwist.com/esohvp0i4jvn/theloseriswhippedtoshreds.jpg)
https://img202.imagetwist.com/th/44718/oqfg8zpharse.jpg (https://imagetwist.com/oqfg8zpharse/theloseriswhippedtoshreds.mp4.jpg)

Description:
Mistress Kendra has brought a couple of new toys to play with. Mistress Kendra brings the slaves on a leash to Mistress Elana and Mistress Kimmy. The Mistress cant decide which slave they want to brutally beat so they have the slaves play a a game of rock paper scissors. One of the slaves loses and now he will be brutally whipped. The Mistress stand up the slave and tie him to a post. Mistress Elena and Mistress Kendra whip the slave to sheds. The Mistress force the slave to thank them for there vicious assault on his back.
Model:
Elena Sin, Kendra James, Kimmylee
Studio:
Clubdom.com
Info:
File Name : theloseriswhippedtoshreds.mp4
File Size : 247.34 MB
Resolution : 640x360
Duration : 00:07:59

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/49548deb36004 (https://tezfiles.com/file/49548deb36004)

Naeite
01-19-2022, 08:35 AM
Clubdom.com- Fucked by Michelle Lacy Lydia
https://img202.imagetwist.com/th/44828/19a4iy8cpigy.jpg (https://imagetwist.com/19a4iy8cpigy/s697michellelacylydiasupremicycattleprodfucked.jpg )
https://img69.imagetwist.com/th/44828/xvgwrw72sij8.jpg (https://imagetwist.com/xvgwrw72sij8/ldeZzUvq.jpg)

Description:
Mistress Michelle Lacy and Goddess Lydia Supremacy decide that it is time to have some fun shocking their slave Bradlina while making him crawl on all fours like the bitch he is. As Mistress Michelle and Goddess Lydia force this pathetic slave on his back taunting him right before they cattle prod his 2 dick making him scream in agony. Next they bend Bradlina over and tear his man pussy up with their 12 black strap-on cocks. While this worthless slave yells for mercy, Goddess Lydia begins to threaten his face with her cattle prod making him beg for his Mistress to fuck his tight man pussy. Next thing this worthless slave knows, is his now gaping asshole is being pile drived by Mistress Michelle. Never ask for mercy at ClubDom
Model:
Lydia Supremacy, Michelle Lacy
Studio:
Clubdom.com
Info:
File Name : s697michellelacylydiasupremicycattleprodfucked.mp4
File Size : 236.27 MB
Resolution : 1280x720
Duration : 00:05:01

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/db36dc3ed8421 (https://tezfiles.com/file/db36dc3ed8421)

Naeite
01-19-2022, 08:51 AM
Clubdom.com- Dahlia Rain Tenderized The Meat
https://img119.imagetwist.com/th/45059/igid18pc9npq.jpg (https://imagetwist.com/igid18pc9npq/cd_s1090_dahliarain_lydiasupremacy_minimovie.jpg)
https://img202.imagetwist.com/th/45059/8y7baei7ydvs.jpg (https://imagetwist.com/8y7baei7ydvs/VgAwNf.jpg)

Description:
Goddess Dahlia Rain wants to play with one of her pathetic bitch slaves. She pulls him out of his cage and shocks his pathetic body with a cattle prod. When Goddess Dahlia thinks he is tenderized enough, she has her slave bend over her whipping horse and starts caning his pale ass. Goddess Dahlia wants her slave to lose his mind with her beatings that he can_t count how many times he_s been caned. Goddess Dahlia Rain is breaking in her new slave and starts teasing him by forcing him to worship her round ass and wet Goddess pussy so he knows what he_s missing out on. Goddess Dahlia then chains him up so she can whip his white skin bright red. Goddess Dahlia rewards the great work by her pathetic slave by allowing him a taste of her pussy from her fingers. Goddess Dahlia Rain wants to stretch out her new slave_s man pussy with her big black cock. She forces her slave_s mouth over her huge strap on cock to lube it up before she starts pegging his slut hole. After his allotted time is up, Goddess Dahlia takes her position behind her slave and fills his tight man pussy with her black dong to make him her personal slut.
Model:
Dahlia Rain
Studio:
Clubdom.com
Info:
File Name : cd_s1090_dahliarain_lydiasupremacy_minimovie.mp4
File Size : 877.41 MB
Resolution : 1280x720
Duration : 00:18:26

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/275f11547974b (https://tezfiles.com/file/275f11547974b)

Naeite
01-19-2022, 08:55 AM
Clubdom.com- Cherry Morgan Alina StrapOn Fuck
https://img202.imagetwist.com/th/44825/ocrvc9ipp23a.jpg (https://imagetwist.com/ocrvc9ipp23a/s633cherrymorganalinalongstrapon.jpg)
https://img69.imagetwist.com/th/44825/a5x2vpgfrfdv.jpg (https://imagetwist.com/a5x2vpgfrfdv/yzSHykMy.jpg)

Description:
Goddess Cherry Morgan and Mistress Alina Long decide its time to pound some man pussy. They instruct the slaves to wrap their lips around the big black cocks and get them tubed up for the anal stretching of their life. The male bitches slobber, gulp and gag on the huge dicks. Then are bent and fucked hard. Begging for every inch the slaves are the flipped over into piledriver and rammed hard and deep squealing and begging for mercy as the ladies make them scream I am an cock whore please fuck me harder.
Model:
Alina Long, Cherry Morgan
Studio:
Clubdom.com
Info:
File Name : s633cherrymorganalinalongstrapon.mp4
File Size : 275.49 MB
Resolution : 1280x720
Duration : 00:05:52

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/1354eac243a68 (https://tezfiles.com/file/1354eac243a68)

Naeite
01-19-2022, 08:58 AM
Clubdom.com- Daisy Ducati Raven Bay Foot POV
https://img119.imagetwist.com/th/44834/sr26g1xzgfom.jpg (https://imagetwist.com/sr26g1xzgfom/s808daisyducatiravenbayfootpov.jpg)
https://img165.imagetwist.com/th/44834/k6o3zxs1rygw.jpg (https://imagetwist.com/k6o3zxs1rygw/rQJHjrM.jpg)

Description:
Goddess Daisy Ducati and Raven Bay are lounging by the pool and notice you staring at their feet, they decide to have some fun with you talking to you and giving you jerk off instruction as they tell you just what a little foot slut you are and how they completely dominate you with their perfectly manicured feet, That_s right foot slut you dream of licking and smelling your Goddess_s beautiful feet as you stroke that tiny 2 inch dicklet of yours spraying your man goo all over your Mistress_s feet and then licking up every last drop foot boy.
Model:
Daisy Ducati, Raven Bay
Studio:
Clubdom.com
Info:
File Name : s808daisyducatiravenbayfootpov.mp4
File Size : 495.26 MB
Resolution : 1280x720
Duration : 00:10:27

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/6d8fad31394b0 (https://tezfiles.com/file/6d8fad31394b0)

Naeite
01-19-2022, 09:07 AM
Clubdom.com- Cum Before She Kicks
https://img119.imagetwist.com/th/45178/v5u3n4hvvubo.jpg (https://imagetwist.com/v5u3n4hvvubo/movie485cfs.jpg)
https://img119.imagetwist.com/th/45178/0bt4g3lo9xnd.jpg (https://imagetwist.com/0bt4g3lo9xnd/MgtcjA.jpg)

Description:
Club Dom features famous Mistresses from around the world engaging in slave training, corporal punishment, ball-busting, CBT, strap-on, and more.
Model:
Teens girls, beautiful girl, milf
Studio:
Clubdom.com
Info:
File Name : movie485cfs.mp4
File Size : 25.57 MB
Resolution : 640x480
Duration : 00:02:09

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/e87bbc2812328 (https://tezfiles.com/file/e87bbc2812328)

Naeite
01-19-2022, 09:19 AM
Clubdom.com- Nothing But A Little Dick Loser
https://img119.imagetwist.com/th/44716/x6t71koigk6k.jpg (https://imagetwist.com/x6t71koigk6k/nothingbutalittledickloser.jpg)
https://img119.imagetwist.com/th/44716/yvupfsjkz6ol.jpg (https://imagetwist.com/yvupfsjkz6ol/nothingbutalittledickloser.mp4.jpg)

Description:
Your so pathetic I see you over there admiring me. You wish you could be at my boots right now. You must like me letting you know what a pathetic loser you are. Is your cock getting hard it looks like a little mosquito bite. Show me that little thing that makes you a disgusting man. Get that dick hard lets see if you can make it grow an extra centimeter. Men like you are nothing all you are is my spit. Start stoking that disgusting filthy little maggot between your legs. Come on stroke that little dicklet. You know how bad you want to smell and touch my beautiful ass. But you could never touch me you can only sit there and stroke your cock to me. That little dick could never please my vagina especially wit your tiny little penis. Now come on cum on my boots. Its so disgusting clean it up now Lick up every drip of the floor and my boots.
Model:
Esmi Lee
Studio:
Clubdom.com
Info:
File Name : nothingbutalittledickloser.mp4
File Size : 109.99 MB
Resolution : 640x360
Duration : 00:04:56

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/5c39bcd459892 (https://tezfiles.com/file/5c39bcd459892)

Naeite
01-19-2022, 09:26 AM
Clubdom.com- Submissive Bitch Slave
https://img119.imagetwist.com/th/45064/3pf3572x4tdr.jpg (https://imagetwist.com/3pf3572x4tdr/cd_s1126_1-4_michellelacy_whipping.jpg)
https://img202.imagetwist.com/th/45064/8qt9nd4cd95i.jpg (https://imagetwist.com/8qt9nd4cd95i/AarAVy.jpg)

Description:
Goddess Michelle Lacy leads her submissive bitch slave into her dungeon with his worthless balls in a vice. After torturing his pathetic slut sacks, she readies her slave for a whipping. Goddess Michelle Lacy_s whip cracks on his pale back leaving bright red welts.
Model:
Michelle Lacy
Studio:
Clubdom.com
Info:
File Name : cd_s1126_1-4_michellelacy_whipping.mp4
File Size : 376.52 MB
Resolution : 1280x720
Duration : 00:08:01

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/c4d32d4222a8e (https://tezfiles.com/file/c4d32d4222a8e)

Naeite
01-19-2022, 09:29 AM
Clubdom.com- Goddess Rilynn Uses Cock To Cum
https://img202.imagetwist.com/th/44715/ldhfceezhh3z.jpg (https://imagetwist.com/ldhfceezhh3z/goddessrilynnusescocktocum.jpg)
https://img119.imagetwist.com/th/44715/398iblieh2d6.jpg (https://imagetwist.com/398iblieh2d6/goddessrilynnusescocktocum.mp4.jpg)

Description:
Mistress Michelle and Goddess Rilynn have there human dildo bound with a hard Cock. Mistress Michelle informs the slave he is going to use his Cock to pleasure Goddess Rilynn. Goddess Rilynn hops on the slave and shoves his Cock in her pussy. Mistress Michelle is sure to let him know this is not for his pleasure and his Cock is only be used for Mistress Rilynn_s enjoyment. Goddess Rilynn rides the slaves Cock as Mistress Michelle continues her verbal assault on the slave. The Mistress make sure that the slave is nothing more then a Cock and this is the only way he will ever feel pussy. After Goddess Rilynn Cums she grinds her pussy on the slaves Cock to Cum again and edge him. After Goddess Rilynn Cums again both the mistress let him know how pathetic he is and leave him bound with blue balls.
Model:
Michelle Lacy, Rilynn Rae
Studio:
Clubdom.com
Info:
File Name : goddessrilynnusescocktocum.mp4
File Size : 126.42 MB
Resolution : 640x360
Duration : 00:05:34

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/aec3ce064c341 (https://tezfiles.com/file/aec3ce064c341)

Naeite
01-19-2022, 09:36 AM
Clubdom.com- Please God, beat my balls harder
https://img202.imagetwist.com/th/45175/ef5z3e8ufbx5.jpg (https://imagetwist.com/ef5z3e8ufbx5/movie802cfs.jpg)
https://img202.imagetwist.com/th/45175/mljhkotsrnkh.jpg (https://imagetwist.com/mljhkotsrnkh/NZIwCqm.jpg)

Description:
Cheyenne is having so much fun punishing her boytoy_s cock and balls. She crops his cock and balls, all the while demanding that he cum. The beating will stop once the man juice spills. The poor guy is hard as a rock but can_t spill the juice. Cheyenne laughs and keeps right on beating his balls and cock. At one point the guy starts to panic and screams, Oh God Cheyenne loves it. She twists his dick around and starts making him call her God. Finally she lays the terrified boy on a sofa and lies over top of him. She gives him an other opportunity to cum. When he just can_t do it, Cheyenne lays in hot and heavy with her crop, loving every sadistic minute.
Model:
Teens girls, beautiful girl, milf
Studio:
Clubdom.com
Info:
File Name : movie802cfs.mp4
File Size : 79 MB
Resolution : 640x480
Duration : 00:06:41

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/aaa48fc30c1d9 (https://tezfiles.com/file/aaa48fc30c1d9)

Naeite
01-19-2022, 09:54 AM
Clubdom.com- Kylie Rogue Nikki Boot Worship
https://img119.imagetwist.com/th/44825/l0wblaqp6wxv.jpg (https://imagetwist.com/l0wblaqp6wxv/s652kylieroguenikkiortagabootworship.jpg)
https://img69.imagetwist.com/th/44825/1wq6q4wi1tis.jpg (https://imagetwist.com/1wq6q4wi1tis/VheMJAi.jpg)

Description:
Goddess Nikki Ortega and Mistress Kylie Rouge torment their slaves teasing these pathetic boot bitches Kylie spreads Nikki_s wet pink Pussy right in the slaves face only letting him look and smell. Then instruct both these slut puppy_s to lick and worship their boots while the Goddess_s make out and rub each others hot pink pussies , laughing as they know theses boot _ have never tasted a woman only licked off the filth from their shiny black stiletto boots.
Model:
Kylie Rogue, Nikki Ortega
Studio:
Clubdom.com
Info:
File Name : s652kylieroguenikkiortagabootworship.mp4
File Size : 399.81 MB
Resolution : 1280x720
Duration : 00:08:25

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/caafa30ebe7b2 (https://tezfiles.com/file/caafa30ebe7b2)

Naeite
01-19-2022, 10:03 AM
Clubdom.com- Bratty Doms Let You Cum
https://img119.imagetwist.com/th/45065/d85z42qv3oxp.jpg (https://imagetwist.com/d85z42qv3oxp/cd_s638_mena_li_racheal_madori_school_girl_pov.jpg )
https://img119.imagetwist.com/th/45065/8il321x3h418.jpg (https://imagetwist.com/8il321x3h418/jrQAIL.jpg)

Description:
Goddess Mena Li and Rachael Madori are dressed in their school girl outfits and strapped up with 12 inches of hard black cock, Wearing their sexy garters and stockings They know they own your pathetic tiny dick ass and instruct you to go ahead and jerk your little dicklet as you dream of them stretching out your man pussy with their big black dicks. That_s it bitch boy go ahead and use your thumb and index finger and jerk of that little slut stick, But remember that the only way you cum is to make sure you have a 12 inch dildo shoved up your ass.
Model:
Mena Li, Mistress Rachael
Studio:
Clubdom.com
Info:
File Name : cd_s638_mena_li_racheal_madori_school_girl_pov.mp4
File Size : 241.44 MB
Resolution : 1280x720
Duration : 00:05:04

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/869234f4dfc48 (https://tezfiles.com/file/869234f4dfc48)

Naeite
01-19-2022, 10:09 AM
Clubdom.com- Your Cheating Balls
https://img119.imagetwist.com/th/45172/06djwdlwns0g.jpg (https://imagetwist.com/06djwdlwns0g/movie415cfs.jpg)
https://img119.imagetwist.com/th/45172/kto5cud7di67.jpg (https://imagetwist.com/kto5cud7di67/JDcFkfce.jpg)

Description:
Lady Cheyenne is furious. Her chastity slave has admitted to jerking once before their meeting. Cheyenne is quite certain he has emptied his balls more than what he is admitting to. She puts his balls in a humbler, hog ties him and whips his cock and balls with a cattle whip. She pauses to feel the fullness of his balls. She knows he is lying. As Cheyenne cuts into his cock and balls with her whip, she reminds him that the only time he is allowed to spill his male filth is on her boot or while she has her strap on cock in his ass. Cheyenne_s slave trembles and moans as she brutalizes his helpers balls with her whip. Then Cheyenne stands him upright and lays into his cock with a riding crop. She promises to blister his cock so that jerking off is so painful, he won_t be tempted. Cheyenne_s slave continues to plead innocence. So, Cheyenne brings out a tablespoon. If her slut can fill it with male filth, she will believe him. Otherwise, She_ll continue punishing his cock and balls. Cheyenne_s slave jerks his hard cock furiously but to no avail. Cheyenne laughs. She knew it all along. Her slut as failed supervised masturbation. As her slut trembles, Cheyenne removes her boots and instructs her slut to place his hands on his head and close his eyes. Her slave nearly breaks down, knowing what is coming next. Cheyenne kicks his cheating balls several times, her slut a good lesson.
Model:
Ball Busting, CBT
Studio:
Clubdom.com
Info:
File Name : movie415cfs.mp4
File Size : 122.28 MB
Resolution : 640x480
Duration : 00:10:29

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/6b9522b2bc077 (https://tezfiles.com/file/6b9522b2bc077)

Naeite
01-19-2022, 10:29 AM
Clubdom.com- Face Slapping the Bitch Slave
https://img119.imagetwist.com/th/45068/qywkdq8rppyo.jpg (https://imagetwist.com/qywkdq8rppyo/cd_s321_face_slap.jpg)
https://img119.imagetwist.com/th/45068/zypq70c5d7uc.jpg (https://imagetwist.com/zypq70c5d7uc/QVWMaUyg.jpg)

Description:
Goddess Brianna is going to teach this slave a lesson he will never forget, by slapping him across the face and reminding him of his place. Brianna delivers hard and stinging slaps with her leather gloved hands to this lowly and pathetic slave. He WILL behave better from now on, or else it_s the cane
Model:
Goddess Brianna
Studio:
Clubdom.com
Info:
File Name : cd_s321_face_slap.mp4
File Size : 171.87 MB
Resolution : 1280x720
Duration : 00:03:43

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/218e4b8ae30f1 (https://tezfiles.com/file/218e4b8ae30f1)

Naeite
01-19-2022, 11:07 AM
Clubdom.com- Whip a Slave Body
https://img202.imagetwist.com/th/45168/ka2n7a91dfvz.jpg (https://imagetwist.com/ka2n7a91dfvz/HAbUSOHF.jpg)
https://img119.imagetwist.com/th/45168/rnduo9qiqi6w.jpg (https://imagetwist.com/rnduo9qiqi6w/YJAIcOEK.jpg)

Description:
Club Dom features famous Mistresses from around the world engaging in slave training, corporal punishment, ball-busting, CBT, strap-on, and more.
Model:
Teens girls, beautiful girl, milf
Studio:
Clubdom.com
Info:
File Name : Movie554.wmv
File Size : 5.88 MB
Resolution : 320x240
Duration : 00:01:35

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/e082ff29f40b6 (https://tezfiles.com/file/e082ff29f40b6)

Naeite
01-19-2022, 11:07 AM
Clubdom.com- Leprechaun Slaves Are Good For Something
https://img119.imagetwist.com/th/45059/16ke88py3qk1.jpg (https://imagetwist.com/16ke88py3qk1/cd_s1141_goddessdahlia_mistresstangent_stpatricksd aycaning.jpg)
https://img202.imagetwist.com/th/45059/aq41plwrn45z.jpg (https://imagetwist.com/aq41plwrn45z/ifvKIuK.jpg)

Description:
Goddess Dahlia and Mistress Tangent ask their pathetic leprechaun slaves if they_re ready for their special St. Patrick_s day ball busting. When one of their slaves collapses after just a few kicks, Goddess Dahlia and Mistress Tangent decide that a special punishment is in order. They bend the pathetically unprepared slave over his cage and begin caning his pale Irish ass. Goddess Dahlia and Mistress Tangent take turns swatting his reddening ass with their canes until her learns his lesson. Their slave_s saggy pink ass cheeks ripple with each swat of Mistress Tangent_s cane as she really beats his leprechaun ass until it turns purple.
Model:
Dahlia Rain, Goddess Tangent
Studio:
Clubdom.com
Info:
File Name : cd_s1141_goddessdahlia_mistresstangent_stpatricksd aycaning.mp4
File Size : 330.01 MB
Resolution : 1280x720
Duration : 00:07:01

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/3e5f1a191de0d (https://tezfiles.com/file/3e5f1a191de0d)

Naeite
01-19-2022, 11:09 AM
Clubdom.com- Scene 300 FemDom Sex
https://img202.imagetwist.com/th/45084/qu50xf4fhlr4.jpg (https://imagetwist.com/qu50xf4fhlr4/cd_s300_full_lenght.jpg)
https://img119.imagetwist.com/th/45084/5c8lip3scttn.jpg (https://imagetwist.com/5c8lip3scttn/hTFsYQz.jpg)

Description:
Never Released The Mistress rides the slave for her pleasure. He isn_t allowed to cum Would you last long? Does he?
Model:
Femdom Sex, fucking, Full Movie
Studio:
Clubdom.com
Info:
File Name : cd_s300_full_lenght.mp4
File Size : 761.42 MB
Resolution : 1280x720
Duration : 00:16:08

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/a416eca6a2fe9 (https://tezfiles.com/file/a416eca6a2fe9)

Naeite
01-19-2022, 11:38 AM
Clubdom.com- Milked To Ruin
https://img119.imagetwist.com/th/44662/xj8hpxdlupkp.jpg (https://imagetwist.com/xj8hpxdlupkp/cd_03_03_13_milking.jpg)
https://img33.imagetwist.com/th/44662/1zqjam3h456k.jpg (https://imagetwist.com/1zqjam3h456k/cd_03_03_13_milking.mp4.jpg)

Description:
Goddess Amadahy and Mistress Tristan are giving one of the stable bitches his every 6 week milking, but it does not mean that it has to be pleasurable. As Tristan milks his cock, Amadahy crushes his balls in her hand, reminding the bitch that this is all about their pleasure, not his.

As the bitch begins to moan, Amadahy puts her hand over his mouth, not wanting to hear anything the slave has to say. As his cock starts spewing cum, Tristan lets go of his cock, letting in hang in the air, as she grabs his balls tight, ruining his orgasm. The Mistresses just laugh at the pathetic bitch and remind him that this was all about their pleasure, not his.
Model:
Goddess Amadahy, Tristan
Studio:
Clubdom.com
Info:
File Name : cd_03_03_13_milking.mp4
File Size : 57.62 MB
Resolution : 640x360
Duration : 00:06:04

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/4a340d931838a (https://tezfiles.com/file/4a340d931838a)

Naeite
01-19-2022, 11:41 AM
Clubdom.com- Clothespins on the Slave Nipples
https://img202.imagetwist.com/th/45182/k0jhrnnxu8dd.jpg (https://imagetwist.com/k0jhrnnxu8dd/pEXiDvxQ.jpg)
https://img119.imagetwist.com/th/45182/732nv6m0auia.jpg (https://imagetwist.com/732nv6m0auia/eCeHKh.jpg)

Description:
Club Dom features famous Mistresses from around the world engaging in slave training, corporal punishment, ball-busting, CBT, strap-on, and more.
Model:
Teens girls, beautiful girl, milf
Studio:
Clubdom.com
Info:
File Name : Movie543.wmv
File Size : 4.35 MB
Resolution : 320x240
Duration : 00:01:09

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/6a98ba3ee3690 (https://tezfiles.com/file/6a98ba3ee3690)

Naeite
01-19-2022, 11:42 AM
Clubdom.com- Cherry Kylie Jerking Your Slut Stick
https://img165.imagetwist.com/th/44831/k4g4mvv97dqi.jpg (https://imagetwist.com/k4g4mvv97dqi/s767cherrymorgankylieroguepov.jpg)
https://img202.imagetwist.com/th/44831/c3mxfilahw5n.jpg (https://imagetwist.com/c3mxfilahw5n/rqXuDvTV.jpg)

Description:
Goddess Kylie Rogue and Goddess Cherry morgan instruct your slutty ass on how to jerk off, With a huge black dildo shoved up your fuck hole, They know it_s what you dream about and what gets you off so go get that big black cock that they told you to buy, Spit on it and plunge it into your asshole, Then take your thumb and forefinger and start jerking that pathetic excuse you call a cock, And their countdown begins you have about 4 minutes to spray that disgusting load of yours.
Model:
Cherry Morgan, Kylie Rogue
Studio:
Clubdom.com
Info:
File Name : s767cherrymorgankylieroguepov.mp4
File Size : 192.02 MB
Resolution : 1280x720
Duration : 00:04:05

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/c2a1e3f3df172 (https://tezfiles.com/file/c2a1e3f3df172)

Naeite
01-19-2022, 11:52 AM
Clubdom.com- Mistress with a StrapOn POV
https://img202.imagetwist.com/th/45074/t85sets6a51l.jpg (https://imagetwist.com/t85sets6a51l/cd_s17.jpg)
https://img119.imagetwist.com/th/45074/nmdxp4rnr3de.jpg (https://imagetwist.com/nmdxp4rnr3de/SnNIxI.jpg)

Description:
Never Released POV Blonde Mistress
Model:
Masturbation Instruction
Studio:
Clubdom.com
Info:
File Name : cd_s17.mp4
File Size : 268.83 MB
Resolution : 1280x720
Duration : 00:05:38

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/0b5a488a8fd61 (https://tezfiles.com/file/0b5a488a8fd61)

Naeite
01-19-2022, 11:55 AM
Clubdom.com- Caning Another Rack of Meat (Brutal Caning)
https://img69.imagetwist.com/th/44823/703pyjs8hj9u.jpg (https://imagetwist.com/703pyjs8hj9u/s575_esmi_natalia_natasha_caning.jpg)
https://img119.imagetwist.com/th/44823/9n3jwzd0zujb.jpg (https://imagetwist.com/9n3jwzd0zujb/EKsIeMwP.jpg)

Description:
Goddess Natasha Starr and Mistress Esmi Lee enjoy another beautiful day at the ClubDom Estate as their slave worships their boots. Mistress Esmi says you ladies up for a little fun? The Goddess_s all agree. Off for a little joy ride they go commanding the slave take them to their rack of meat. As they arrive to the next slave shackled to the caning bench the ladies inform the slut that it_s time for their morning work out. Some caning cardio while destroying his ass. Making him beg for the cane. Proceeding to mercilessly cane the bitches ass over and over, cane stroke after cane stroke. Completely destroying this bitches ass. The ladies high five each other and begun to laugh. This bitches day has only just begun.
Model:
Esmi Lee, Natalia Starr, Natasha Starr
Studio:
Clubdom.com
Info:
File Name : s575_esmi_natalia_natasha_caning.mp4
File Size : 335.37 MB
Resolution : 1280x720
Duration : 00:07:06

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/ccc078ca4a32b (https://tezfiles.com/file/ccc078ca4a32b)

Naeite
01-19-2022, 11:56 AM
Clubdom.com- Tug-A-Balls Competition
https://img119.imagetwist.com/th/45065/bv47b8q8w5o7.jpg (https://imagetwist.com/bv47b8q8w5o7/cd_s1163_nikkibrooks_bellaink_tugaballs.jpg)
https://img202.imagetwist.com/th/45065/ac5ebnue4fq3.jpg (https://imagetwist.com/ac5ebnue4fq3/LRSYRO.jpg)

Description:
Goddess Bella Ink and Goddess Nikki Brooks want to see which of their pathetic slaves has the strong cock. They tie a rope between two of their slave_s balls and tell them they are now in a tug of balls, and if they lose, they lose their worthless balls. Goddess Nikki Brooks pulls the rope so the slaves know they aren_t joking and mean business. Goddess Bella Ink laughs at how purple their balls are turning, and laughs harder as she pulls on the rope even more. Goddess Bella Ink and Nikki Brooks each choose a slave and try to encourage them to win the tug a balls by showing their pussies and tits.
Model:
Bella Ink, Nikki Brooks
Studio:
Clubdom.com
Info:
File Name : cd_s1163_nikkibrooks_bellaink_tugaballs.mp4
File Size : 222.58 MB
Resolution : 1280x720
Duration : 00:04:42

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/6db2861fe06d5 (https://tezfiles.com/file/6db2861fe06d5)

Naeite
01-19-2022, 11:59 AM
Clubdom.com- Jean Bardot_s Sissy Training Part 3: Stretching For Sluts
https://img119.imagetwist.com/th/45077/w90afrzcucan.jpg (https://imagetwist.com/w90afrzcucan/cd_s1251_3-5_jean_sissystrapon.jpg)
https://img202.imagetwist.com/th/45077/5qw8b4x2ebn9.jpg (https://imagetwist.com/5qw8b4x2ebn9/tclbmw.jpg)

Description:
Jean Bardot is on a mission to turn her sissy into a total whore for her. She is continuing his training with even larger cocks for the bitch to take. Jean knows its just as important to work the mouth as it is for her to work the male pussy hole. She relentlessly fucks him, training him to take it, showing him that she means business when it comes to slut-training him.
Model:
Jean Bardot
Studio:
Clubdom.com
Info:
File Name : cd_s1251_3-5_jean_sissystrapon.mp4
File Size : 362.58 MB
Resolution : 1280x720
Duration : 00:07:44

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/d6068120abe85 (https://tezfiles.com/file/d6068120abe85)

Naeite
01-19-2022, 12:07 PM
Clubdom.com- Take That Dick In Your Ass
https://img119.imagetwist.com/th/44662/td4j5734emlc.jpg (https://imagetwist.com/td4j5734emlc/cd_03_16_13_dildoass.jpg)
https://img119.imagetwist.com/th/44662/xvau1rn890w0.jpg (https://imagetwist.com/xvau1rn890w0/cd_03_16_13_dildoass.mp4.jpg)

Description:
Mistress Venus gifts Mistress Esmi with her personal slave, telling Esmi to destroy his ass for her amusement, and Esmi does just that, jackhammering a huge double sided dildo in and out of the slave_s ass until it looks like it is about to turn inside out Esmi just laughs at his pain and fucks him harder the more he squirms and squeals

Venus wants to have some fun too, so they turn the bitch onto his back so Venus can take his ass with an even larger cock. Esmi begins jerking the bitch off, making him beg for release. When he cums, the bitch squirts all over Esmi_s hand Esmi is disgusted and makes him eat every bit of his filth off of her hand.
Model:
Esmi Lee, Venus Divine
Studio:
Clubdom.com
Info:
File Name : cd_03_16_13_dildoass.mp4
File Size : 63.08 MB
Resolution : 640x360
Duration : 00:06:34

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/eca8a495a5d4f (https://tezfiles.com/file/eca8a495a5d4f)

Naeite
01-19-2022, 12:08 PM
Clubdom.com- Price to Pay Bullwhipping
https://img119.imagetwist.com/th/45168/vbv5auee1twk.jpg (https://imagetwist.com/vbv5auee1twk/movie602cfs.jpg)
https://img202.imagetwist.com/th/45168/qn5vmgscxuki.jpg (https://imagetwist.com/qn5vmgscxuki/AFNsGHg.jpg)

Description:
Cheyenne is simply furious with her personal slave. This is no game She chains her bitch to her dungeon wall and lays into his back, shoulders and ass with her bull whip. Cheyenne has no mercy. Cheyenne_s slave pleads with Her to believe in his sincerity. Cheyenne is having none of her bitch_s cries for sincerity or mercy. She devours him with her leather bullwhip. Do you WANT to serve MISTRESS? Cheyenne demands her trembling bitch to answer.Then you pay the price and be grateful Cheyenne beams as she delivers lash after brutal lash with her single tail whip.
Model:
Teens girls, beautiful girl, milf
Studio:
Clubdom.com
Info:
File Name : movie602cfs.mp4
File Size : 71.67 MB
Resolution : 640x480
Duration : 00:06:12

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/2848b11f2902e (https://tezfiles.com/file/2848b11f2902e)

Naeite
01-19-2022, 12:14 PM
Clubdom.com- Goddess Cheyenne Jean Bardot POV
https://img202.imagetwist.com/th/45055/cumm519ez885.jpg (https://imagetwist.com/cumm519ez885/cd_s1100_goddesscheyenne_mistressjeanbardot_pov.jp g)
https://img119.imagetwist.com/th/45055/p24uahws5h7r.jpg (https://imagetwist.com/p24uahws5h7r/dUetMv.jpg)

Description:
Goddess Cheyenne and Mistress Jean Bardot are standing in front of you in their latex and are getting disgusted by your pathetic little balls. They think they need to be crushed and abused by their feet since your little grpgs are worthless and useless.
Model:
Goddess Cheyenne, Jean Bardot
Studio:
Clubdom.com
Info:
File Name : cd_s1100_goddesscheyenne_mistressjeanbardot_pov.mp 4
File Size : 211.58 MB
Resolution : 1280x720
Duration : 00:04:30

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/8da32816ea1a7 (https://tezfiles.com/file/8da32816ea1a7)

Naeite
01-19-2022, 12:26 PM
Clubdom.com- School Girls From Hell 2: Fuck Machine
https://img119.imagetwist.com/th/45071/o3ce12cm14kn.jpg (https://imagetwist.com/o3ce12cm14kn/cd_s1206_evelinstone_kenziereeves_fuckmachine.jpg)
https://img119.imagetwist.com/th/45071/46qmupz8q81k.jpg (https://imagetwist.com/46qmupz8q81k/YzlqzMe.jpg)

Description:
Evelin Stone and Kenzie Reeves are the two toughest girls in their school. They love using their gorgeous looks to get whatever they want. When approached by Toby and Steve, they decide to show them just how they are getting straight As this year. They pull the boys into their dungeon. One boy escapes, but Steve is over powered and thrown into a cage. On top of the cage, the girls have their teacher bound and afraid. They have an injection which they give in straight into his balls. If is to fuck the girls, and if he cums, his balls will shrivel up and wither away to nothing. He fucks Evelin good and hard after Kenzie rubs her tight young pussy all over his big cock. Unfortunately for the teacher, he cums.
Model:
Evelin Stone, Kenzie Reeves
Studio:
Clubdom.com
Info:
File Name : cd_s1206_evelinstone_kenziereeves_fuckmachine.mp4
File Size : 370.78 MB
Resolution : 1280x720
Duration : 00:07:50

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/f59da7b8dec16 (https://tezfiles.com/file/f59da7b8dec16)

Naeite
01-19-2022, 12:36 PM
Clubdom.com- Breaking Slave 23
https://img119.imagetwist.com/th/45063/m3gmoabfj2sb.jpg (https://imagetwist.com/m3gmoabfj2sb/cd_s1130_full_mistresslydia_mistresscheyenne_minim ovie.jpg)
https://img202.imagetwist.com/th/45063/lw6fx471ifv3.jpg (https://imagetwist.com/lw6fx471ifv3/DBgLqNv.jpg)

Description:
Mistress Lydia Supremacy and Mistress Cheyenne have caught a spy slave who is trying to smuggle out information to a competeing dungeon. He claims to be unbreakable, but Mistress Lydia and Mistress Cheyenne will see about that. Mistress Lydia and Mistress Cheyenne start their interrogation torture with some wooden paddles they use to paddle his traitorous pathetic pale white ass. The slaves ass turns bright red, but remains silent as the Mistresses upgrade their paddles to bigger versions. Mistress Cheyenne asks him some questions then paddles his traitorous ass, then Mistress Lydia baseball swings her paddle eliciting cries of pain. Mistress Lydia Supremacy and Mistress Cheyenne are excited that the traitor slave they caught didn_t break during phase one of their interrogation. It has been a long long time since they have had to go to phase two: caning. They don_t waste much time before they start caning their prisoner slave. His pathetic slave ass is still red from phase one of their interrogation, but they brutally start caning his ass leaving dark red welts under his bright red skin. Mistress Lydia and Mistress Cheyenne don_t care if they break their canes over his ass, as they have many of them to go through, and they don_t hold back when they cane their slave. They remind him that his pain can be over as soon as he gives up the information, though they do rather enjoy the caning, so they hope he keeps his mouth shut so they can torture him longer. Mistress Lydia Supremacy and Mistress Cheyenne are surprised that their captured traitor slave has made it to phase three, whipping. They have the traitor slave tied up to a rack with handcuffs still unwilling to give up the information. Both Mistress Lydia and Mistress Cheyenne know that will won_t last long as they warm up their whips. Mistress Lydia lays into him first with her red suede whip that she lashes across his back from close range before Mistress Cheyenne unleashes her long black horse whip on his red back flesh. The pain from the whipping makes their slave dance in agony while he needlessly holds onto the information, making his Mistresses more and more angry. It_s not long however, until Mistress Lydia and Mistress Cheyenne break his will and he dances in pain while repeating the information he was going to sell.
Model:
Goddess Cheyenne, Lydia Supremacy
Studio:
Clubdom.com
Info:
File Name : cd_s1130_full_mistresslydia_mistresscheyenne_minim ovie.mp4
File Size : 849.75 MB
Resolution : 1280x720
Duration : 00:17:53

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/f50e208a417ee (https://tezfiles.com/file/f50e208a417ee)

Naeite
01-19-2022, 12:40 PM
Clubdom.com- Kendra Punishes Her Slave: Ballbusting
https://img202.imagetwist.com/th/45181/bn9xhdyi6468.jpg (https://imagetwist.com/bn9xhdyi6468/cd_1305_kendrajames_ballbusting.jpg)
https://img202.imagetwist.com/th/45181/vp83eydsy8yx.jpg (https://imagetwist.com/vp83eydsy8yx/ZTyyUW.jpg)

Description:
Goddess Kendra is getting impatient with her slave. He is not being attentive enough for her taste. She has to tell him to come closer to her. The slave crawls over to his Goddess and she demands that he worship and lick her shiny black boots. She is becoming angry because she has to remind him to worship the other boot and the stupid slave doesnt even thank her for the privilege. Goddess Kendra is about to show her slave what happens when slaves dont meet her high expectations. Her bitch slave is ordered to stand in front of her with his legs spread and his hands over his head. Goddess Kendra doesnt believe in warmups when punishing her slaves. She kicks him in the nuts with enough force that he falls to the ground in agony. Kendra orders him to stay on the ground and spread his legs. She tells him how worthless he is and steps on his balls with the tip of her pointy boots. The pathetic slave is told to take off Goddess Kendras boots so she can continue to assault his balls with her bare feet. This slave is learning the hard way what happens when you piss off Goddess Kendra. Kendra grabs the slave hard by his balls and reminds him again that his balls belongs to her. The slave agrees and has learned his lesson. But Goddess Kendra is just getting started
Model:
Kendra James
Studio:
Clubdom.com
Info:
File Name : cd_1305_kendrajames_ballbusting.mp4
File Size : 374.42 MB
Resolution : 1280x720
Duration : 00:07:56

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/b8cf52e16e4a4 (https://tezfiles.com/file/b8cf52e16e4a4)

Naeite
01-19-2022, 12:51 PM
Clubdom.com- Balls for Breakfast
https://img119.imagetwist.com/th/45172/zqwoxb49j07g.jpg (https://imagetwist.com/zqwoxb49j07g/movie408cfs.jpg)
https://img119.imagetwist.com/th/45172/v49m13p11f86.jpg (https://imagetwist.com/v49m13p11f86/IgpQZju.jpg)

Description:
Did you ever fantasize about what it would be like to wake up in Lady Cheyenne_s bed? This victim finds himself in a bit of a predicament. Cheyenne has time tied spread eagle to her four poster bed and his ball locked into a humbler as she greets him with her bull whip. Cheyenne beats the slave_s ass and balls brutally as the slave thrashes on her bed, pleading for mercy. Cheyenne is absolutely brutal as she lays into her captives_s balls. She is fueled by his protests, squeezing his balls between her fingers and laughing about popping them. Her slave is somewhat in disbelief as Cheyenne refuses to put down her whip. What a great way to start out a morning Cheyenne exclaims as she continues to beat the slave_s balls brutally.
Model:
Teens girls, beautiful girl, milf
Studio:
Clubdom.com
Info:
File Name : movie408cfs.mp4
File Size : 56.37 MB
Resolution : 640x480
Duration : 00:04:49

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/079e038f4991e (https://tezfiles.com/file/079e038f4991e)

Naeite
01-19-2022, 12:52 PM
Clubdom.com- Filling The Slaves Slut Holes
https://img202.imagetwist.com/th/44714/uhj4zmhdh38q.jpg (https://imagetwist.com/uhj4zmhdh38q/fillingtheslavesslutholes.jpg)
https://img119.imagetwist.com/th/44714/tvbv9qr1k52p.jpg (https://imagetwist.com/tvbv9qr1k52p/fillingtheslavesslutholes.mp4.jpg)

Description:
The Mistress do not waste time shoving there big black cocks in the slaves ass The slave takes it in both his slut holes. The Mistress shove a big cock in his mouth and a big cock in his man pussy. The Mistress Make the slave take all of there cocks. The slaves screams are muffled by there cocks going deep down his throat. The Mistress make sure to humiliate him by reiterating that hes taking big black cocks in his holes.
Model:
Elena Sin, Mia Martinez
Studio:
Clubdom.com
Info:
File Name : fillingtheslavesslutholes.mp4
File Size : 143.84 MB
Resolution : 640x360
Duration : 00:06:25

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/fbe67cc1909a4 (https://tezfiles.com/file/fbe67cc1909a4)

Naeite
01-19-2022, 12:54 PM
Clubdom.com- Dava Foxx Kylie Chindo
https://img119.imagetwist.com/th/44824/mbiqfbbj2jzs.jpg (https://imagetwist.com/mbiqfbbj2jzs/s619davafoxxkylieroguechidocaning.jpg)
https://img202.imagetwist.com/th/44824/b0mibtidacdv.jpg (https://imagetwist.com/b0mibtidacdv/BxwxYan.jpg)

Description:
Goddess Dava Foxx and Mistress Kylie Rogue tell their bitch it_s time to make his mistress cum. They strap a dildo gag to the slaves face and tell him he has exactly 3 minutes to make each of them get off. Of course one stipulation is that he will be brutally caned by the other while he fucks. Goddess Dava tells the bitch remember this is your sole purpose in life, it is the price of servitude.
Model:
Dava Foxx, Kylie Rogue
Studio:
Clubdom.com
Info:
File Name : s619davafoxxkylieroguechidocaning.mp4
File Size : 334.43 MB
Resolution : 1280x720
Duration : 00:07:04

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/33fb83c6e6647 (https://tezfiles.com/file/33fb83c6e6647)

Naeite
01-19-2022, 12:55 PM
Clubdom.com- Smacking a Slave
https://img119.imagetwist.com/th/45169/6w4a7vxc8eas.jpg (https://imagetwist.com/6w4a7vxc8eas/hOlwWGJ.jpg)
https://img202.imagetwist.com/th/45169/0syin0877ovs.jpg (https://imagetwist.com/0syin0877ovs/MCeGJn.jpg)

Description:
Club Dom features famous Mistresses from around the world engaging in slave training, corporal punishment, ball-busting, CBT, strap-on, and more.
Model:
Teens girls, beautiful girl, milf
Studio:
Clubdom.com
Info:
File Name : Movie490.wmv
File Size : 6.93 MB
Resolution : 320x240
Duration : 00:01:52

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/763e4864e350d (https://tezfiles.com/file/763e4864e350d)

Naeite
01-19-2022, 12:56 PM
Clubdom.com- Grappling Mistress_s Part 1
https://img119.imagetwist.com/th/44715/iklym1gobyt9.jpg (https://imagetwist.com/iklym1gobyt9/grapplingmistressspt1.jpg)
https://img119.imagetwist.com/th/44716/rhafsazvsa3h.jpg (https://imagetwist.com/rhafsazvsa3h/grapplingmistressspt1.mp4.jpg)

Description:
Goddess Amadahy and Mistress Mia are conversing on how women are much more stronger nowadays and they can kick ass just like the guys. All of a sudden Thor comes in and demands his mat. Thor claims he has that mat reserved and he wants it. The Mistress_s laugh at him and make fun of his puny physic. The Mistress_s make a wager with the loser. If he can beat them in grappling he will be allowed to have the mat but if he loses he will have to take a strap on up the ass. Thor thinks the Mistress_s will be easy to defeat to bad for him he does not know what he got himself into. The Mistress_s make short work of the loser and easily defeat him through submissions and take downs.
Model:
Goddess Amadahy, Mistress Mia
Studio:
Clubdom.com
Info:
File Name : grapplingmistressspt1.mp4
File Size : 37.76 MB
Resolution : 640x360
Duration : 00:01:41

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/71d67718a9ac4 (https://tezfiles.com/file/71d67718a9ac4)

Naeite
01-19-2022, 12:56 PM
Clubdom.com- Stroke Your Slut Stick POV
https://img33.imagetwist.com/th/44825/i379bss99h8z.jpg (https://imagetwist.com/i379bss99h8z/s660jamievalentinepov.jpg)
https://img33.imagetwist.com/th/44825/fkhg7xcqra0f.jpg (https://imagetwist.com/fkhg7xcqra0f/pXqBPmg.jpg)

Description:
Mistress Jamie Valentine Knows you love looking at her big round tits and stroking your pathetic slut stick. You have a 2 in tiny dicklett and would give anything just to be near Mistress Jamie_s shiny black boots and hot sexy curvy body. So go ahead and use your thumb and index finger and stroke every last drop of filth into a teaspoon and slurp up every last drop.
Model:
Jamie Valentine
Studio:
Clubdom.com
Info:
File Name : s660jamievalentinepov.mp4
File Size : 342.87 MB
Resolution : 1280x720
Duration : 00:07:12

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/41e48fb7f12fe (https://tezfiles.com/file/41e48fb7f12fe)

Naeite
01-19-2022, 12:57 PM
Clubdom.com- Goddess Tangent_s Punished Slut
https://img119.imagetwist.com/th/45084/7l036i343af7.jpg (https://imagetwist.com/7l036i343af7/cd_s1275_goddesstangent_strapon.jpg)
https://img202.imagetwist.com/th/45084/z1plrwkv582a.jpg (https://imagetwist.com/z1plrwkv582a/DbBciEk.jpg)

Description:
Goddess Tangent has her sissy all dolled up. She tells her slut what is in store for her as she finishes applying the most obnoxiously pink lipstick on her slut_s lips. She bends the slut over and wants his ass to be nice and punished and red for her. Why? Because this slut was not good enough the last time at sucking cock and taking cock. So Goddess Tangent must make sure the slut does a better job and she starts first by paddling her sissy, making her ass match her slutty lips.
Model:
Goddess Tangent
Studio:
Clubdom.com
Info:
File Name : cd_s1275_goddesstangent_strapon.mp4
File Size : 281.04 MB
Resolution : 1280x720
Duration : 00:05:56

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/56ab62b7b1ca6 (https://tezfiles.com/file/56ab62b7b1ca6)

Naeite
01-19-2022, 12:57 PM
Clubdom.com- Alexis_s Fuck Monkey Sucks Cock
https://img119.imagetwist.com/th/44830/3t4pfx512kaq.jpg (https://imagetwist.com/3t4pfx512kaq/s7893-4alexisfawxstrapontoby.jpg)
https://img119.imagetwist.com/th/44830/dofh6bu9mx9d.jpg (https://imagetwist.com/dofh6bu9mx9d/dQZMiCiO.jpg)

Description:
Goddess Alexis Fawx gives her new fuck monkey BlowJob instruction on how to properly suck her 12 inch strap on cock, She shoves it right down his fuck hole laughing as he gags on every inch, She makes him beg as he gargles pathetic spit bubbles, Telling him she wants that spit running down his face as she fucks this bitch_s face even harder, Making him eat her dick and beg for more calling him her manwhore. (Pt 2-4)
Model:
Alexis Fawx
Studio:
Clubdom.com
Info:
File Name : s7893-4alexisfawxstrapontoby.mp4
File Size : 294.17 MB
Resolution : 1280x720
Duration : 00:06:13

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/815f380b84031 (https://tezfiles.com/file/815f380b84031)

Naeite
01-19-2022, 12:59 PM
Clubdom.com- A Hard Knee to the Groin
https://img202.imagetwist.com/th/45168/w01adc2wajjd.jpg (https://imagetwist.com/w01adc2wajjd/iUdzXH.jpg)
https://img119.imagetwist.com/th/45168/w4kovkkxzq2g.jpg (https://imagetwist.com/w4kovkkxzq2g/cMXHMYi.jpg)

Description:
Club Dom features famous Mistresses from around the world engaging in slave training, corporal punishment, ball-busting, CBT, strap-on, and more.
Model:
Teens girls, beautiful girl, milf
Studio:
Clubdom.com
Info:
File Name : Movie542.wmv
File Size : 7.1 MB
Resolution : 320x240
Duration : 00:01:54

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/197cd6d421e60 (https://tezfiles.com/file/197cd6d421e60)

Naeite
01-19-2022, 01:06 PM
Clubdom.com- Fucked Owned and Used
https://img119.imagetwist.com/th/45048/x8s9esk2voe0.jpg (https://imagetwist.com/x8s9esk2voe0/cd_s976_jeanbardot_parisknight_strapon.jpg)
https://img119.imagetwist.com/th/45048/yc4zb0u3crow.jpg (https://imagetwist.com/yc4zb0u3crow/NhGUiMj.jpg)

Description:
Paris Knight and Jean Bardot stuff the faces of their man slaves with their superior femdom cocks, ramming them deep down their drooling face-holes. The men have to take every inch down their throats as they stare up at the gorgeous latex-clad Goddesses who own them. The Mistresses decide to bend the two _ over their own cages and fuck them hard and deep in their pathetic asses until they feel totally humiliated and owned. It_s not enough that the women laugh and taunt them as they pound their holes but Paris decides to visit and join in on the fun and instructs slave 122 to lick her pussy while he gets fucked by Mistress Paris. The slave has no choice but to obey. He can taste her wet pussy and is overwhelmed by the power of all three women.
Model:
Jean Bardot, Paris Knight
Studio:
Clubdom.com
Info:
File Name : cd_s976_jeanbardot_parisknight_strapon.mp4
File Size : 396.53 MB
Resolution : 1280x720
Duration : 00:08:23

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/750cdab48f07c (https://tezfiles.com/file/750cdab48f07c)

Naeite
01-19-2022, 01:10 PM
Clubdom.com- Hurt To Cum
https://img119.imagetwist.com/th/44663/g2ur84erdhhn.jpg (https://imagetwist.com/g2ur84erdhhn/cd_03_17_13_femdompov.jpg)
https://img33.imagetwist.com/th/44663/goaw6irbdm3r.jpg (https://imagetwist.com/goaw6irbdm3r/cd_03_17_13_femdompov.mp4.jpg)

Description:
Mistresses January and Esmi know what you are doing, jerking off your small cock to their clips without their permission. Well, today is your lucky day, because they are actually going to let you jerk off - but you have to earn it first. And the only way to earn favor with these sadists is to hurt yourself - bad

Want to jerk that cock? You had better do it with hot sauce - and make sure plenty gets inside your cock to burn that urethra Can you keep your little dick hard while punching yourself in the balls? How do three fingers feel in your ass - with hot sauce as your only lube? If you want the privilege of jerking off, you will do all this and much more
Model:
Esmi Lee, January Seraph
Studio:
Clubdom.com
Info:
File Name : cd_03_17_13_femdompov.mp4
File Size : 297.18 MB
Resolution : 1280x720
Duration : 00:06:15

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/ab668f137f10b (https://tezfiles.com/file/ab668f137f10b)

Naeite
01-19-2022, 01:22 PM
Clubdom.com- Milking Day with Sadie Holmes
https://img119.imagetwist.com/th/45078/7gs5y9c9o0pc.jpg (https://imagetwist.com/7gs5y9c9o0pc/cd_s1269_sadieholmes_handjob.jpg)
https://img119.imagetwist.com/th/45078/qzkfuo3077ca.jpg (https://imagetwist.com/qzkfuo3077ca/kFhmjS.jpg)

Description:
It_s milking day and Goddess Sadie Holmes is going to drain this bitch slave dry. Sadie knows just how to edge and build up the slave to where the release is going to be explosive and thoroughly empty his balls. Chastity devices fit better on empty balls, it_s how you can tell the best size for a slave This slave must endure the humiliation of Sadie draining him and making him eat his own filth.
Model:
Sadie Holmes
Studio:
Clubdom.com
Info:
File Name : cd_s1269_sadieholmes_handjob.mp4
File Size : 316.12 MB
Resolution : 1280x720
Duration : 00:06:42

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/d0ba4922eaa3f (https://tezfiles.com/file/d0ba4922eaa3f)

Naeite
01-19-2022, 01:32 PM
Clubdom.com- Esmi Lee Halloween Full Movie
https://img119.imagetwist.com/th/45184/sx54wtrs21vv.jpg (https://imagetwist.com/sx54wtrs21vv/cd_s1065_full_esmileehw.jpg)
https://img202.imagetwist.com/th/45185/5s0obljosrbs.jpg (https://imagetwist.com/5s0obljosrbs/oXAqarK.jpg)

Description:
Club Dom features famous Mistresses from around the world engaging in slave training, corporal punishment, ball-busting, CBT, strap-on, and more.
Model:
Esmi Lee
Studio:
Clubdom.com
Info:
File Name : cd_s1065_full_esmileehw.mp4
File Size : 586.19 MB
Resolution : 1280x720
Duration : 00:12:21

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/1b1e6a676ecad (https://tezfiles.com/file/1b1e6a676ecad)

Naeite
01-19-2022, 01:43 PM
Clubdom.com- Boot Licking Pony-Boys
https://img202.imagetwist.com/th/45051/xs4k1wod20fn.jpg (https://imagetwist.com/xs4k1wod20fn/cd_s1056_dahliaharlow__cat.jpg)
https://img202.imagetwist.com/th/45051/4zmb905ef12h.jpg (https://imagetwist.com/4zmb905ef12h/PbsljfBH.jpg)

Description:
Mistress Dahlia Rain and Goddess Harlow Harrison are enjoying a nice day of pony-cart rides. They each have their slave licking their shiny boots clean. The slaves are naked of course, wearing only a collar, sweating in the hot sun and nothing more than pets made to amuse their Mistresses. The women instruct and taunt the slaves as they lick every single inch. Afterwards, they decide to have a race. The winning slave is caught giggling at the losing slave. The ladies decide to drag him inside for punishment.
Model:
Dahlia Rain, Harlow Harrison
Studio:
Clubdom.com
Info:
File Name : cd_s1056_dahliaharlow_ponycat.mp4
File Size : 271.08 MB
Resolution : 1280x720
Duration : 00:05:44

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/b50b658ac821e (https://tezfiles.com/file/b50b658ac821e)

Naeite
01-19-2022, 01:43 PM
Clubdom.com- Part 2 Stepping it up After the Warm up
https://img202.imagetwist.com/th/45079/5wrcrd30pp7t.jpg (https://imagetwist.com/5wrcrd30pp7t/bLnGPfBX.jpg)
https://img119.imagetwist.com/th/45079/fudu2qgm2pks.jpg (https://imagetwist.com/fudu2qgm2pks/gRSZFh.jpg)

Description:
Club Dom features famous Mistresses from around the world engaging in slave training, corporal punishment, ball-busting, CBT, strap-on, and more.
Model:
Teens girls, beautiful girl, milf
Studio:
Clubdom.com
Info:
File Name : Movie337.wmv
File Size : 11.97 MB
Resolution : 320x240
Duration : 00:03:13

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/98ff7f9dc247d (https://tezfiles.com/file/98ff7f9dc247d)

Naeite
01-19-2022, 01:50 PM
Clubdom.com- Cock Slut for the Queen
https://img202.imagetwist.com/th/45051/g37w46z05bgi.jpg (https://imagetwist.com/g37w46z05bgi/cd_s1047_qandisa_amadahy_pov1.jpg)
https://img119.imagetwist.com/th/45051/5y2wbonyd348.jpg (https://imagetwist.com/5y2wbonyd348/thdLTtf.jpg)

Description:
There you are cock slut, kneeling before your QUEEN, begging for cock in your little slut mouth. Your Queen, your Goddess has you trained well. She is in a good mood and decides she is going to give it to you. She makes you take her big hard cock into your mouth. You will behave and take it all, taking her every direction.
Model:
Goddess Amadahy, Queen Qandisa
Studio:
Clubdom.com
Info:
File Name : cd_s1047_qandisa_amadahy_pov1.mp4
File Size : 239.75 MB
Resolution : 1280x720
Duration : 00:05:05

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/377d2538ce057 (https://tezfiles.com/file/377d2538ce057)

Naeite
01-19-2022, 01:59 PM
Clubdom.com- Canning To A Pulp
https://img119.imagetwist.com/th/44668/wlyqhljrdh8o.jpg (https://imagetwist.com/wlyqhljrdh8o/canningtoapulp.jpg)
https://img33.imagetwist.com/th/44668/rl8cuk3slo3i.jpg (https://imagetwist.com/rl8cuk3slo3i/canningtoapulp.mp4.jpg)

Description:
Mistress Alexis and Mistress Macy are her to destroy this slaves defenseless ass. The Mistresses taunt the slave first by making him kiss there cains and beg for his beating. Mistress Alexis loves to beat an ass to a pulp and it shows. Mistress Alexis beats his ass non stop and only takes a break to allow Mistress Macy to have her turn. The Mistresses spare no mercy on the slaves ass. The Mistresses want this slave to be in pain The Mistresses both cain this pathetic slave till his ass is nothing more then hamburger meat. The Mistress paint a pretty picture on his as of slashes and welts.
Model:
Alexis Grace, Macy Cartel
Studio:
Clubdom.com
Info:
File Name : canningtoapulp.mp4
File Size : 167.96 MB
Resolution : 640x360
Duration : 00:07:33

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/538fc5b1813cb (https://tezfiles.com/file/538fc5b1813cb)

Naeite
01-19-2022, 02:01 PM
Clubdom.com- Dual Cocks
https://img119.imagetwist.com/th/44717/8oewrz3wkdiw.jpg (https://imagetwist.com/8oewrz3wkdiw/dualcocks.jpg)
https://img119.imagetwist.com/th/44717/4et7z01u7yjp.jpg (https://imagetwist.com/4et7z01u7yjp/dualcocks.mp4.jpg)

Description:
Mistress Jamie and Mistress Nikki are smoking cigarettes when they come up with an idea to stretch there slaves assholes. The Mistress are both wearing big black cocks and make there slave gag on there cocks. The Mistress then bend over there slave and fuck the slave like the dirty cock loving _ they are. The slaves cry and whimper but the Mistress just make them beg for more.
Model:
Jamie Valentine, Nikki Delano
Studio:
Clubdom.com
Info:
File Name : dualcocks.mp4
File Size : 215.87 MB
Resolution : 640x360
Duration : 00:07:00

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/d52b9d2b09360 (https://tezfiles.com/file/d52b9d2b09360)

Naeite
01-19-2022, 02:09 PM
Clubdom.com- Make You Goddess Cum with 3 Mistresses
https://img202.imagetwist.com/th/44745/e952juvsk1eg.jpg (https://imagetwist.com/e952juvsk1eg/s473_make_your_goddess_cum_pussy_eat_bg_vanessa_al exa_riley.jpg)
https://img202.imagetwist.com/th/44745/2x8ag2zfm9mg.jpg (https://imagetwist.com/2x8ag2zfm9mg/s473_make_your_goddess_cum_pussy_eat_bg_vanessa_al exa_riley.mp4.jpg)

Description:
Club Dom features famous Mistresses from around the world engaging in slave training, corporal punishment, ball-busting, CBT, strap-on, and more.
Model:
Alexa Rydell, Riley Reynolds, Vanessa Cage
Studio:
Clubdom.com
Info:
File Name : s473_make_your_goddess_cum_pussy_eat_bg_vanessa_al exa_riley.mp4
File Size : 317.34 MB
Resolution : 1280x720
Duration : 00:06:42

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/9700fb0b5a916 (https://tezfiles.com/file/9700fb0b5a916)

Naeite
01-19-2022, 02:13 PM
Clubdom.com- Do These Come Off
https://img119.imagetwist.com/th/45166/7y3l7l9gwrd9.jpg (https://imagetwist.com/7y3l7l9gwrd9/ehGdPuNK.jpg)
https://img202.imagetwist.com/th/45166/cswgre9k9uug.jpg (https://imagetwist.com/cswgre9k9uug/YjJJGmc.jpg)

Description:
Club Dom features famous Mistresses from around the world engaging in slave training, corporal punishment, ball-busting, CBT, strap-on, and more.
Model:
Teens girls, beautiful girl, milf
Studio:
Clubdom.com
Info:
File Name : Movie512.wmv
File Size : 7.2 MB
Resolution : 320x240
Duration : 00:01:56

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/947823e68189f (https://tezfiles.com/file/947823e68189f)

Naeite
01-19-2022, 02:15 PM
Clubdom.com- Megan Fucks Like She Fights
https://img119.imagetwist.com/th/45043/xxq1etr904bs.jpg (https://imagetwist.com/xxq1etr904bs/04meaganfighting.jpg)
https://img119.imagetwist.com/th/45043/7pcn5in6qd6e.jpg (https://imagetwist.com/7pcn5in6qd6e/KdaYBquB.jpg)

Description:
Megan Jones owns another ass today She can_t wait to show a loud mouth loser what a real champ is. Wrestling, kicking, and choking the sissy out. when Megan see_s he_s had enough, she pulls out the next part of his punishment. Her Strap on, which she will need lube for since she is going to fuck the loser. Kneel down and jerk your filth onto the big black cock, get it nice and wet because when it slide into that manpussy...it will be hard and rough. Megan fucks like she fights and sissy boys will be lining up outside the gym to bend over for her. Ding ding ding, Round one
Model:
Megan Jones
Studio:
Clubdom.com
Info:
File Name : 04meaganfighting.mp4
File Size : 883.59 MB
Resolution : 1280x720
Duration : 00:18:39

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/2f3f3a868ec84 (https://tezfiles.com/file/2f3f3a868ec84)

Naeite
01-19-2022, 02:17 PM
Clubdom.com- Feel My Essence
https://img202.imagetwist.com/th/44659/sy13i16b9wy9.jpg (https://imagetwist.com/sy13i16b9wy9/cd_02_17_13_pussysquirt.jpg)
https://img202.imagetwist.com/th/44659/lt0o1uwcp13r.jpg (https://imagetwist.com/lt0o1uwcp13r/cd_02_17_13_pussysquirt.mp4.jpg)

Description:
Mistress Esmi knows that her slave craves her pussy, but he is far too unworthy to ever be allowed to enjoy such a privilege. Esmi laughs at how pathetic he is, locked in a cage and craving what he will never have.

Esmi and her friend Mistress Courtney mercilessly tease the caged bitch by playing with their pussies while mocking him, but Esmi does want to allow the slave to feel the essence of her pussy. Esmi pleasures herself with a vibrator, making the bitch beg to feel her pussy juices on his skin. Esmi squirts all over his back, then makes sure the bitch gets a good smell of her essence. All the better to torment her pussy addicted bitch even further.
Model:
Courtney, Esmi Lee
Studio:
Clubdom.com
Info:
File Name : cd_02_17_13_pussysquirt.mp4
File Size : 41.67 MB
Resolution : 640x360
Duration : 00:05:16

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/0c5d7ce321813 (https://tezfiles.com/file/0c5d7ce321813)

Naeite
01-19-2022, 02:38 PM
Clubdom.com- Fucking Fifi_s Gaping Ass
https://img119.imagetwist.com/th/45070/3w46idcjuspd.jpg (https://imagetwist.com/3w46idcjuspd/cd_s639_mena_li_racheal_madori_strap_on_maid.jpg)
https://img202.imagetwist.com/th/45070/q8tsabahm70n.jpg (https://imagetwist.com/q8tsabahm70n/xOcIIoED.jpg)

Description:
The Estates resident maid FiFi is dusting the dungeon floor with a feather duster shoved up her ass. Mistress Mena Li and Goddess Rachael Madori are amused and snap their fingers telling FiFi it_s time for him to clean off their big 12 inch strapons. Wrap your lips around my big black cock and lube it up so I can fuck your man pussy. Fifi complies. They bend the bitch over and sadistically thrust their big huge cock in and out of both his fuck holes. Taking turns at pound his ass while stretching his gaping ass wide open. Mistress Mena now flips the bitch on his back so she can drive her cock even deeper. After she has finished fucking the bitch they both tell him to get back to cleaning. He grabs the feather duster with his hand and starts to dust and told oh no, go back to the way you were, put it back in your ass.
Model:
Mena Li, Mistress Rachael
Studio:
Clubdom.com
Info:
File Name : cd_s639_mena_li_racheal_madori_strap_on_maid.mp4
File Size : 315.03 MB
Resolution : 1280x720
Duration : 00:06:40

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/c83928e3787e8 (https://tezfiles.com/file/c83928e3787e8)

Naeite
01-19-2022, 02:42 PM
Clubdom.com- Jessica Ryan Elana: Chindo Bitch
https://img165.imagetwist.com/th/44669/pmced6bi765t.jpg (https://imagetwist.com/pmced6bi765t/chindobitch.jpg)
https://img202.imagetwist.com/th/44669/uk89ynzsjn94.jpg (https://imagetwist.com/uk89ynzsjn94/chindobitch.mp4.jpg)

Description:
Mistress Elana and Mistress Jessica Ryan have a use less slave. The slave has puny dick and could never give a woman any real pleasure. The Mistress_s put a chindo on his face so he can at least use him for something. Jessica Ryan forces his face into her pussy and fucks it. Jessica and Elan both laugh at what a loser he is and how he has to to wear a chindo just give a woman pleasure. Jessica fucks the loser the slave till she cums all over him.
Model:
Elena Sin, Jessica Ryan
Studio:
Clubdom.com
Info:
File Name : chindobitch.mp4
File Size : 155.56 MB
Resolution : 640x360
Duration : 00:06:59

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/17ff0706b1e4e (https://tezfiles.com/file/17ff0706b1e4e)

Naeite
01-19-2022, 02:49 PM
Clubdom.com- Superior Femdom StapOn
https://img69.imagetwist.com/th/44835/v6hox8oao0x1.jpg (https://imagetwist.com/v6hox8oao0x1/s855kylieroguemichellelacystrapon3.jpg)
https://img202.imagetwist.com/th/44835/0fz9swapcf51.jpg (https://imagetwist.com/0fz9swapcf51/BzjWUGh.jpg)

Description:
After shocked with the cattle prod Goddess Kylie Rogue and Mistress Michelle Lacy bend their slaves over the fuck horse and tell them to prepare to take superior femdom cocks up your ass as we stretch out your pathetic man pussies filling you with every inch of our hard black strap on dicks. That_s right stretching your anus to its maximum capacity bitch. We will ass pound and fuck you hard and long till you_re screaming and begging for every inch. After riding their slutty asses long and hard the ladies cattle prod one of the slaves right into the pool as the ladies high five and laugh at how fun it is, owning men.
Model:
Kylie Rogue, Michelle Lacy
Studio:
Clubdom.com
Info:
File Name : s855kylieroguemichellelacystrapon3.mp4
File Size : 329.69 MB
Resolution : 1280x720
Duration : 00:06:50

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/0b9699b3d9f74 (https://tezfiles.com/file/0b9699b3d9f74)

Naeite
01-19-2022, 02:49 PM
Clubdom.com- Tiny Dicks Untriumphant Return Part 3
https://img202.imagetwist.com/th/44669/owv6908qsl46.jpg (https://imagetwist.com/owv6908qsl46/tinydicksuntriumphantreturnp3.jpg)
https://img119.imagetwist.com/th/44669/dm6c72yf9wep.jpg (https://imagetwist.com/dm6c72yf9wep/tinydicksuntriumphantreturnp3.mp4.jpg)

Description:
Goddess Amadahy and Goddess Riylnn are gloating about the asking kicking they give Tiny Dick and his Trainer moments ago. All of a sudden a puny loser comes in claiming the gym is his fathers and after the distractions they caused earlier they need to leave Goddess Amadahy chuckles and let this loser know that Rilynn and her do what they want when they want The loser gets furious and lets the Goddess_s know his father is the famous El Torro Loco and he will be pissed if they are here when he gets back. Amadahy shows how much she cares by coming up to the loser and smacking his face. The loser cries foul and cant believe Amadahy just hit him. Amadahy claims she did not hit him but whats coming will really hurt. All of a sudden Rilynn does a handstand and wraps her legs around the losers neck. Rylinn has the losers neck in a hold with her legs then flips him over. Rylnn then quickly gets to the losers back to put him in a submission. The loser gets up and continues to tell the girls he needs they need to leave. The Goddess are not going anywhere but if the loser wants to continue they will keep making him submit till he goes away. Rylinn does most the damage and Amadahy joins in here and there to inflict pain and humiliate. Finally Goddess Rylinn puts the loser in a scissor hold and the loser submits one last time.
Model:
Goddess Amadahy
Studio:
Clubdom.com
Info:
File Name : tinydicksuntriumphantreturnp3.mp4
File Size : 156.38 MB
Resolution : 640x360
Duration : 00:07:02

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/0ac77668ba563 (https://tezfiles.com/file/0ac77668ba563)

Naeite
01-19-2022, 02:55 PM
Clubdom.com- Nadia and Goddess Valora Gimp Milking
https://img119.imagetwist.com/th/45053/ynwnly5bdfqt.jpg (https://imagetwist.com/ynwnly5bdfqt/cd_s1079_nadiawhite_goddessvalora_milking.jpg)
https://img119.imagetwist.com/th/45053/7wxfjbmudki7.jpg (https://imagetwist.com/7wxfjbmudki7/WcUshqJ.jpg)

Description:
Goddess Nadia White and Goddess Valora know it_s time to feed their gimp slave. They have the slave in the milking chair while they stroke his filthy slut stick. After the slave spills his man batter, Goddess Nadia smears the filth on the slaves face so he can get fed.
Model:
Goddess Valora, Nadia White
Studio:
Clubdom.com
Info:
File Name : cd_s1079_nadiawhite_goddessvalora_milking.mp4
File Size : 422.77 MB
Resolution : 1280x720
Duration : 00:08:58

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/0c473c75aec35 (https://tezfiles.com/file/0c473c75aec35)

Naeite
01-19-2022, 03:05 PM
Clubdom.com- Goddess Cheyenne Jean Bardot StrapOn
https://img119.imagetwist.com/th/45056/mpge8tmzh0y4.jpg (https://imagetwist.com/mpge8tmzh0y4/cd_s1101_goddesscheyenne_mistressjeanbardot_strapo n.jpg)
https://img119.imagetwist.com/th/45056/tmtpxehq2age.jpg (https://imagetwist.com/tmtpxehq2age/IIZuEybb.jpg)

Description:
Goddess Cheyenne and Mistress Jean Bardot demand that their slave comes over and worship their big black cocks. They force their slave to suck on each of their strap on cocks. Goddess Cheyenne then bends him over to ram her cock all the way in his tight man pussy while he sucks Mistress Jean Bardot_s black cock.
Model:
Goddess Cheyenne, Jean Bardot
Studio:
Clubdom.com
Info:
File Name : cd_s1101_goddesscheyenne_mistressjeanbardot_strapo n.mp4
File Size : 251.75 MB
Resolution : 1280x720
Duration : 00:05:18

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/6f4e3e55b8101 (https://tezfiles.com/file/6f4e3e55b8101)

Naeite
01-19-2022, 03:07 PM
Clubdom.com- Beat up by 2 Goddesses Part 1
https://img165.imagetwist.com/th/44821/cfki4czfakka.jpg (https://imagetwist.com/cfki4czfakka/s512_minimovie_cheyenne_jewel_amadahy_part1.jpg)
https://img119.imagetwist.com/th/44821/qja1ld8vk52q.jpg (https://imagetwist.com/qja1ld8vk52q/FUHNgHF.jpg)

Description:
Cheyenne Jewel and Goddess Amadahy are out to teach a lesson to a lippy male bitch. The Ladies proceed to kick his little pansy ass. From a full nelson to a scissor-hold, the Goddesss_s humiliate the slut for having such a pathetic dicklett as they emasculate him with their strong arms and expert thighs. At one point the male bitch_s face is turning bright red as Amadahy wraps her strong thighs around his neck. Cheyenne laughs. This is just the beginning for this little bitch.
Model:
Cheyenne Jewel, Goddess Amadahy
Studio:
Clubdom.com
Info:
File Name : s512_minimovie_cheyenne_jewel_amadahy_part1.mp4
File Size : 272.92 MB
Resolution : 1280x720
Duration : 00:05:47

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/c5bc3695c30c5 (https://tezfiles.com/file/c5bc3695c30c5)

Naeite
01-19-2022, 03:15 PM
Clubdom.com- Dream of their Goddess Cocks
https://img119.imagetwist.com/th/45069/ak1oapapp92m.jpg (https://imagetwist.com/ak1oapapp92m/cd_s1139_nadiawhite_nyssanevers_straponpov.jpg)
https://img202.imagetwist.com/th/45069/mc4ub6dr6vld.jpg (https://imagetwist.com/mc4ub6dr6vld/rZIApA.jpg)

Description:
Goddess Nadia White and Goddess Nyssa Nevers are wearing corsets and strap on black cocks, standing in front of you, stroking their big black cocks, wondering if you want your boy pussy stuffed. The Goddesses start planning on how to fuck your slut hole with their big cocks. They know you want to be DP_d, and want to take turns having you suck their dick while the other fucks your ass, forcing you to suck off your own ass juice.
Model:
Nadia White, Nyssa Nevers
Studio:
Clubdom.com
Info:
File Name : cd_s1139_nadiawhite_nyssanevers_straponpov.mp4
File Size : 307.81 MB
Resolution : 1280x720
Duration : 00:06:31

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/a493433d4fdaa (https://tezfiles.com/file/a493433d4fdaa)

Naeite
01-19-2022, 03:17 PM
Clubdom.com- Kylie Rogue Jamie Strapon Sucking
https://img69.imagetwist.com/th/44824/1krvsbwxi3u4.jpg (https://imagetwist.com/1krvsbwxi3u4/s611kylieroguejamievalentinestrapon.jpg)
https://img202.imagetwist.com/th/44824/uexbn2hztoo8.jpg (https://imagetwist.com/uexbn2hztoo8/KSdqdq.jpg)

Description:
Goddess Jamie Valentine and Mistress Kylie Rogue decide it_s time to fuck some man pussy. They pull their blind folded slave out of his cage and instruct him to open his slutty mouth. They proceed to fill it with 12 inches of black hard cock. Informing him that this is the lube that they will be using to stretch open his pussy hole. Look at this pathetic drool. Thats right bitch lube it up good. He is restrained and bent over and both take turns stretching out his gaping man pussy. Jamie gives the bitch a ride. Slapping his ass as she pounds him over and over. Then Goddess Kylie takes a turn wearing out his slutty ass. Filling it to its maximum capacity. Jamie comments so far up his ass I think he_s choking on it. The ladies high five each other laughing and continue to pound away.
Model:
Jamie Valentine, Kylie Rogue
Studio:
Clubdom.com
Info:
File Name : s611kylieroguejamievalentinestrapon.mp4
File Size : 336.77 MB
Resolution : 1280x720
Duration : 00:07:04

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/50ec4209cf834 (https://tezfiles.com/file/50ec4209cf834)

Naeite
01-19-2022, 03:19 PM
Clubdom.com- Edge, Edge, Eat
https://img202.imagetwist.com/th/44738/t8t12u0v274v.jpg (https://imagetwist.com/t8t12u0v274v/s428_minimovie_charlyse_angel_kendra_james_part4.j pg)
https://img33.imagetwist.com/th/44738/kxugf8b0z2a9.jpg (https://imagetwist.com/kxugf8b0z2a9/s428_minimovie_charlyse_angel_kendra_james_part4.m p4.jpg)

Description:
Kendra James and Charylse have a slut strapped down on his back. The ladies delight in tormenting this male bitch. Charylse teases the slut_s hard cock with her soft hands, getting him right to the edge and then pulling back. Kendra laughs, watching this slut get right to the edge only to be denied. Charylse finally has mercy and allows the male bitch to release his filth. After the slut cums all over himself, he is made to eat his own cum.
Model:
Charlyse Angel, Kendra James
Studio:
Clubdom.com
Info:
File Name : s428_minimovie_charlyse_angel_kendra_james_part4.m p4
File Size : 283.03 MB
Resolution : 1280x720
Duration : 00:05:59

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/f0528c4a6d2aa (https://tezfiles.com/file/f0528c4a6d2aa)

Naeite
01-19-2022, 03:21 PM
Clubdom.com- Tangent_s Plans For Sissy Bitch
https://img202.imagetwist.com/th/45178/82o60xnwozxx.jpg (https://imagetwist.com/82o60xnwozxx/cd_s1319_tangent_strapon.jpg)
https://img202.imagetwist.com/th/45178/llchm7ksfgvf.jpg (https://imagetwist.com/llchm7ksfgvf/xcUayITW.jpg)

Description:
Goddess Tangent has more plans for her sissy bitch. On his knees, he is ready to try to please his Goddess. Goddess Tangent is wearing one of her favorite strap ons, her big red as she likes to call it. Mere seconds into this, the sissy slut is choking and gagging on her big red. Goddess Tangent has a handful of his hair, face fucking him without mercy. When she allows him to come up for air, she slaps his face, and spits right into his pathetic mouth. Goddess Tangent has him bend over, after the brutal face fucking. Now its time to drive up the rear. Goddess Tangent has him bent over the spanking bench, and slams his ass with her big red. She pounds away, regardless of his screams and yelps. Goddess Tangent is balls deep with her big red.
Model:
Goddess Tangent
Studio:
Clubdom.com
Info:
File Name : cd_s1319_tangent_strapon.mp4
File Size : 280.08 MB
Resolution : 1280x720
Duration : 00:05:56

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/db722d522eef0 (https://tezfiles.com/file/db722d522eef0)

Naeite
01-19-2022, 03:21 PM
Clubdom.com- Sheena_s Bootlicking Slave
https://img119.imagetwist.com/th/45179/rx35wxcdk2wt.jpg (https://imagetwist.com/rx35wxcdk2wt/cd_s1325_sheenaryder_faceslapbootworship.jpg)
https://img119.imagetwist.com/th/45179/xc58jf72c5mn.jpg (https://imagetwist.com/xc58jf72c5mn/GrZMdd.jpg)

Description:
Goddess Sheena Ryder just wants to enjoy her afternoon, a glass of wine, a slave around at her beck and call to wait on her hand and foot. Goddess Sheena patiently waits for her wine, and much to her dismay not only is she waiting too long, but her wine is inadequate as well. Goddess Sheena is extremely unhappy that her relaxing afternoon is ruined by a pathetic slave, that is inefficient and tardy. He must be punished. Goddess Sheena decides on a sound face slapping. She spits on his face and in his mouth, and follows it up with some verbal abuse and more face slapping. Goddess Sheena truly enjoys punishing her slaves, and this time is no different. When Goddess Sheena is satisfied, she decides to try this slave out again. A simple task, a boot cleaning with his tongue. Knowing this slave needs explicit instructions, Goddess Sheena directs him on how shed like her boots licked. Of course he takes too long, and once again upsets Goddess Sheenaperhaps its time for more punishment??
Model:
Sheena Ryder
Studio:
Clubdom.com
Info:
File Name : cd_s1325_sheenaryder_faceslapbootworship.mp4
File Size : 386.72 MB
Resolution : 1280x720
Duration : 00:08:10

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/6eb38fdd19811 (https://tezfiles.com/file/6eb38fdd19811)

Naeite
01-19-2022, 03:23 PM
Clubdom.com- Degraded Fuckhole Initiation
https://img119.imagetwist.com/th/44660/curai58y89f9.jpg (https://imagetwist.com/curai58y89f9/cd_03_09_13_strapon.jpg)
https://img33.imagetwist.com/th/44660/giwah765ymq9.jpg (https://imagetwist.com/giwah765ymq9/cd_03_09_13_strapon.mp4.jpg)

Description:
Goddess Amadahy loves making her slaves into mindless fuckholes that she can use and abuse with her strapon cocks whenever she wants to be amused. Amadahy is very excited because she has a virgin to the strapon that she is going to ruthlessly break with the help of her friend Mistress Vendetta.

While Vendetta has fun making the bitch suck on her dick, Amadahy mercilessly pounds her slave_s ass with her cock, her hips violently shaking his entire body as she thrusts into him again and again. When the bitch tries to escape from the pain, she just grabs him by the collar and uses it as a handle to fuck him even harder. When she has finished having her fun, Amadahy tells her slave that this is how he will spend the rest of his life, just a degraded fuckhole for her to use whenever she feels like it. To remind him of his pathetic place in her life, she then makes him suck down all of his ass juices off of her cock, heartlessly degrading and dehumanizing him. All the better to make him a humbly compliant fuckhole slave for life.
Model:
Goddess Amadahy, Tristan
Studio:
Clubdom.com
Info:
File Name : cd_03_09_13_strapon.mp4
File Size : 365.54 MB
Resolution : 1280x720
Duration : 00:07:43

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/0c051653be7dc (https://tezfiles.com/file/0c051653be7dc)

Naeite
01-19-2022, 03:43 PM
Clubdom.com- Fucking Fit For A Slave
https://img119.imagetwist.com/th/45172/yoykui87boui.jpg (https://imagetwist.com/yoykui87boui/movie411cfs.jpg)
https://img202.imagetwist.com/th/45172/nr27xl3xabyl.jpg (https://imagetwist.com/nr27xl3xabyl/dXiwFeM.jpg)

Description:
Cheyenne leans close to her bitch and whispers that she wants to fuck him. The slave_s cock gets hard. He isn_t quite certain just what Cheyenne means by that but he like it. Then she lifts her nighty to reveal her strap on cock. She drives her dick deep into her bitch_s ass. She grabs up his cock and smacks it with a leather paddle. Pumping her slave full of dick, Cheyenne squeezes his balls and holds them up so she can watch her cock slide in and out of her bitch_s hole. Oh, Cheyenne loves fucking her slave. This is the only way a man should be allowed to fuck.
Model:
Teens girls, beautiful girl, milf
Studio:
Clubdom.com
Info:
File Name : movie411cfs.mp4
File Size : 41.99 MB
Resolution : 640x480
Duration : 00:03:33

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/df573a0147f65 (https://tezfiles.com/file/df573a0147f65)

Naeite
01-19-2022, 03:54 PM
Clubdom.com- Milking day for cum slut‏
https://img202.imagetwist.com/th/45056/hm8qzkn8qxpj.jpg (https://imagetwist.com/hm8qzkn8qxpj/cd_s508_cheyenne_jewel_amadahy_hj.jpg)
https://img202.imagetwist.com/th/45057/5o97e5bsvssv.jpg (https://imagetwist.com/5o97e5bsvssv/zxoUii.jpg)

Description:
Goddess Amadahy and Cheyenne Jewel have it in for a particular slave. They strap him to a table and wheel him and begin to extract his male filth. The ladies are expecting a full load as the male bitch has been chastity bound for 36 days. Cheyennes soft hands go to work on the slut_s hard cock as Amadahy knows that she will grab his balls and and twist and slap them while goddess Cheyenne extracts the male filth right out of his swollen slut sacks. All the while, Cheyenne reminds the male bitch that if he doesn_t produce enough filth, he will be forced to endure another 36 days of chastity. Either way, this slut loses. When the male bitch gets right to the point of cumming but hold backs, Amadahy puts her hand over his mouth as Cheyenne extracts every drop of the bitch_s male filth. Then they feed him all his nourishment for the next 36 days.
Model:
Cheyenne Jewel, Goddess Amadahy
Studio:
Clubdom.com
Info:
File Name : cd_s508_cheyenne_jewel_amadahy_hj.mp4
File Size : 343 MB
Resolution : 1280x720
Duration : 00:07:16

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/f682574d7fab3 (https://tezfiles.com/file/f682574d7fab3)

Naeite
01-19-2022, 03:58 PM
Clubdom.com- Esmi Lee Isobel Devi Fuck With Strap Ons
https://img119.imagetwist.com/th/45051/0a6portddut3.jpg (https://imagetwist.com/0a6portddut3/cd_s1064_2-2_esmilee_isobeldevi_strapon.jpg)
https://img202.imagetwist.com/th/45051/m8ktnlc67q13.jpg (https://imagetwist.com/m8ktnlc67q13/bMWvkI.jpg)

Description:
Goddesses Esmi Lee and Isobel Devi are ready to break in their new pathetic slaves. They pull them out of their cage and force them to lube up their big black strap on cocks with their tight mouths. After their slaves get their black cocks lubed up with spit, they bend their new slaves over and fuck their virgin asses. The Goddesses stuff their slave_s man pussies deep and hard before sending them off screaming into the night.
Model:
Esmi Lee, Isobel Devi
Studio:
Clubdom.com
Info:
File Name : cd_s1064_2-2_esmilee_isobeldevi_strapon.mp4
File Size : 394.34 MB
Resolution : 1280x720
Duration : 00:08:24

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/34c8fcc6902ef (https://tezfiles.com/file/34c8fcc6902ef)

Naeite
01-19-2022, 04:07 PM
Clubdom.com- No Mercy From Their Whips
https://img119.imagetwist.com/th/44653/rbmy7wytqoy0.jpg (https://imagetwist.com/rbmy7wytqoy0/cd_scene_12_16_12_whipping.jpg)
https://img165.imagetwist.com/th/44653/bolf5avoma4u.jpg (https://imagetwist.com/bolf5avoma4u/cd_scene_12_16_12_whipping.mp4.jpg)

Description:
Mistress Kendra and Goddess Amadahy have gotten some new whips and are in the mood to break them in on this stable slave. They make him crawl across the field on their leash and bind him to their whipping post.

Secured and helpless, the bitch can only beg for mercy as he is cruelly lashed by both Mistresses at the same time. As the Mistresses remind him, they have no mercy. The Mistresses only stop to inspect the marks on his back, letting him know they are far from finished with him
Model:
Goddess Amadahy, Kendra James
Studio:
Clubdom.com
Info:
File Name : cd_scene_12_16_12_whipping.mp4
File Size : 47.37 MB
Resolution : 640x360
Duration : 00:05:58

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/fdef40c371306 (https://tezfiles.com/file/fdef40c371306)

Naeite
01-19-2022, 04:22 PM
Clubdom.com- Uses Tongs to Pull
https://img119.imagetwist.com/th/45083/h1lzj677evwu.jpg (https://imagetwist.com/h1lzj677evwu/PAMPqOeb.jpg)
https://img202.imagetwist.com/th/45083/0cp5eps21rqb.jpg (https://imagetwist.com/0cp5eps21rqb/WUVgAYBp.jpg)

Description:
Club Dom features famous Mistresses from around the world engaging in slave training, corporal punishment, ball-busting, CBT, strap-on, and more.
Model:
Teens girls, beautiful girl, milf
Studio:
Clubdom.com
Info:
File Name : Movie486.wmv
File Size : 5.94 MB
Resolution : 320x240
Duration : 00:01:35

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/b5f64c9f7d8e5 (https://tezfiles.com/file/b5f64c9f7d8e5)

Naeite
01-19-2022, 04:33 PM
Clubdom.com- Chindo Fucking Reward
https://img119.imagetwist.com/th/45061/xidj2onn5jp9.jpg (https://imagetwist.com/xidj2onn5jp9/cd_s1135_nadiawhite_nyssanevers_chindo.jpg)
https://img119.imagetwist.com/th/45061/wjiownt91sa0.jpg (https://imagetwist.com/wjiownt91sa0/gvRbJKUw.jpg)

Description:
Goddess Nadia White and Goddess Nyssa Nevers chase their slave into their dungeon to have some fun. The latex wearing Goddesses have electroshock prods they use to direct their pathetic slave where they want until they surround him and use the electroshock prods on his disgusting filth sacks. Goddess Nadia White places her thigh high latex boots on his throat while Goddess Nyssa Nevers shocks his tiny disgusting useless ball sack. After they torture their slave_s balls for a bit, they tease him with their beautiful pink Goddess pussies, but won_t let his unworthy hands near them. Instead, they force him to wear a chindo on his head, demanding him to fuck Goddess Nadia White with the chindo and to make her cum, or they will castrate him.
Model:
Nadia White, Nyssa Nevers
Studio:
Clubdom.com
Info:
File Name : cd_s1135_nadiawhite_nyssanevers_chindo.mp4
File Size : 325.7 MB
Resolution : 1280x720
Duration : 00:06:55

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/82520b742fd10 (https://tezfiles.com/file/82520b742fd10)

Naeite
01-19-2022, 04:40 PM
Clubdom.com- Kicking: Constant Action
https://img119.imagetwist.com/th/45183/anw8y5mk39xx.jpg (https://imagetwist.com/anw8y5mk39xx/YAejrF.jpg)
https://img119.imagetwist.com/th/45183/t1mp32ksdfyy.jpg (https://imagetwist.com/t1mp32ksdfyy/haYkSSf.jpg)

Description:
This is a shorter version of the same clip, edited for non stop action.
Model:
Teens girls, beautiful girl, milf
Studio:
Clubdom.com
Info:
File Name : Movie94CFSsh.wmv
File Size : 65.09 MB
Resolution : 640x480
Duration : 00:06:01

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/3258e7eff984d (https://tezfiles.com/file/3258e7eff984d)

Naeite
01-19-2022, 04:43 PM
Clubdom.com- Rub your Little Winky POV
https://img119.imagetwist.com/th/45043/exehisng65s8.jpg (https://imagetwist.com/exehisng65s8/cd_s900_michellelacy_natalyasadici_isobeldevil_lyd iasupremacy_natalyapov2.jpg)
https://img119.imagetwist.com/th/45043/tgywo41ahmr4.jpg (https://imagetwist.com/tgywo41ahmr4/ehVDVOuh.jpg)

Description:
Mistress Lydia is inspecting the body of a new slave and can barely contain her laughter when she sees the size of his small penis. Lydia unleashes a barrage of humiliating comments, all belittling him for his shortcomings. Lydia is curious about whether such a tiny dick can actually be jerked to orgasm so she gives the slave permission to masturbate of course, if he succeeds he will eat up his filth in a most humiliating way.
Model:
Lydia Supremacy
Studio:
Clubdom.com
Info:
File Name : cd_s900_michellelacy_natalyasadici_isobeldevil_lyd iasupremacy_natalyapov2.mp4
File Size : 249.86 MB
Resolution : 1280x720
Duration : 00:05:20

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/cf52472408453 (https://tezfiles.com/file/cf52472408453)

Naeite
01-19-2022, 04:45 PM
Clubdom.com- Lick Our Ash
https://img33.imagetwist.com/th/44659/z5flhdb8uybv.jpg (https://imagetwist.com/z5flhdb8uybv/cd_02_05_13_smoking.jpg)
https://img202.imagetwist.com/th/44659/49kpf113lrsk.jpg (https://imagetwist.com/49kpf113lrsk/cd_02_05_13_smoking.mp4.jpg)

Description:
Mistresses Kendra and Elena have been dominating their bitch all day and decide to have a smoke break. Of course, their bitch_s work is not done, as they need an ashtray while they smoke. As he is already at their boots, they order him to clean them as well, laughing as they tell the bitch all the dirty and disgusting places their boots have been.

Just when the bitch thinks Elena_s boot is clean, she ashes her cigarette on it, ordering him to clean it properly. The bitch soon understands that, no matter how well he licks their filthy boots, the Mistresses are just going to keep them dirty with their cigarette ash. The only break the bitch gets from cleaning his Mistress_s dirty boots is when they order him to serve directly as their ashtray. The Mistresses enjoy their relaxation while thoroughly working and humiliating their slave bitch, laughing at their control over him as they degrade him.
Model:
Elena Sin, Kendra James
Studio:
Clubdom.com
Info:
File Name : cd_02_05_13_smoking.mp4
File Size : 53.49 MB
Resolution : 640x360
Duration : 00:06:40

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/19465bc7b1ac8 (https://tezfiles.com/file/19465bc7b1ac8)

Naeite
01-19-2022, 04:55 PM
Clubdom.com- At Jean_s Boots
https://img119.imagetwist.com/th/45079/0vgy3z2rxoe4.jpg (https://imagetwist.com/0vgy3z2rxoe4/cd_s1261_jeanbardot_bootworship.jpg)
https://img202.imagetwist.com/th/45079/qcu091iqtv1k.jpg (https://imagetwist.com/qcu091iqtv1k/kQlgsZ.jpg)

Description:
The pathetic slave is not worthy of Jean Bardot. He is barely worthy to be in the same room as her. Lucky for him, she is allowing him to serve her today and he must entertain her by worshipping her perfect boots. The slave is instructed to lick every single inch of Jean_s sexy boots and he is afraid to do a bad job. It gets him horny thinking about how privileged he is to have his tongue on her body through her boot, but he also knows he is destined to be a slave.
Model:
Jean Bardot
Studio:
Clubdom.com
Info:
File Name : cd_s1261_jeanbardot_bootworship.mp4
File Size : 297.33 MB
Resolution : 1280x720
Duration : 00:06:19

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/4ee5167170cba (https://tezfiles.com/file/4ee5167170cba)

Naeite
01-19-2022, 05:00 PM
Clubdom.com- Punish Your Pecker
https://img165.imagetwist.com/th/44653/nbmq53kosmou.jpg (https://imagetwist.com/nbmq53kosmou/cd_12_30_12_joipov.jpg)
https://img202.imagetwist.com/th/44654/bwwen0znz4xv.jpg (https://imagetwist.com/bwwen0znz4xv/cd_12_30_12_joipov.mp4.jpg)

Description:
Goddess Brianna knows you are a helpless horny pervert, lusting after her beautiful breasts and ass. But there is a cost the only way she will allow you to play with your little pecker is if you hurt it. Smack it - scratch it - make it hurt. If you hurt your little dicklette enough, maybe she will actually let you cum. But you had better do it exactly when she allows, because Brianna has no patience for pathetic pecker jerkers.
Model:
Goddess Brianna
Studio:
Clubdom.com
Info:
File Name : cd_12_30_12_joipov.mp4
File Size : 53.27 MB
Resolution : 640x360
Duration : 00:06:38

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/b6634c3e6c484 (https://tezfiles.com/file/b6634c3e6c484)

Naeite
01-19-2022, 05:04 PM
Clubdom.com- Chin Strap Bitch
https://img33.imagetwist.com/th/44667/lbrq2ud14u3t.jpg (https://imagetwist.com/lbrq2ud14u3t/chinstrapbitch.jpg)
https://img119.imagetwist.com/th/44667/cvulpkxeq2dz.jpg (https://imagetwist.com/cvulpkxeq2dz/chinstrapbitch.mp4.jpg)

Description:
Goddess Brianna and Mistress Belle Noir have put a chin strap dildo on there slave and have made them there chin strap bitch. The Mistress are going to fuck his face to there pleasure and to his humiliation. The Mistresses let him know those pathetic cock and balls he has means nothing to them, Goddess Brianna has attached a ball zapper to him and gives him a good shock to let him know she is serious. Goddess Brianna lets him know he is going to fuck mistress Belle with his chin strap and he better make her cum Goddess Brianna shocks him as he fucks Mistress belle with his chin strap when he is not doing a good enough job. Mistress Belle likes to see her the slave in pain and it begins to turn her on more. Mistress Belle asks Brianna to keep shocking the slaves because it makes her want to cum. Goddess Brinna turns up the watts on the zapper. Every shock gets Mistress Belle closer and closer to orgasm. Finally Mistress Belle comes to an orgasm all over the slaves face. The Mistresses then force him to the floor for further humiliation. The Mistresses make him kiss there feet as they give him a few more shocks till he is allowed to leave.
Model:
Belle Noir, Goddess Brianna
Studio:
Clubdom.com
Info:
File Name : chinstrapbitch.mp4
File Size : 172.2 MB
Resolution : 640x360
Duration : 00:07:40

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/6c89ffabf5c39 (https://tezfiles.com/file/6c89ffabf5c39)

Naeite
01-19-2022, 05:16 PM
Clubdom.com- Jerk That Tiny Dicklette
https://img119.imagetwist.com/th/45071/lzmys4vfgaif.jpg (https://imagetwist.com/lzmys4vfgaif/cd_s1160_nikkibrooks_bellaink_jerkoffpov.jpg)
https://img202.imagetwist.com/th/45071/5i8aopaebc50.jpg (https://imagetwist.com/5i8aopaebc50/AfpTwAvK.jpg)

Description:
Goddesses Bella Ink and Nikki Brooks dragged you into the dungeon so they can watch you jerk your pathetic tiny little cock. The Goddesses are wearing latex dresses and thigh high boots, but can_t help but chuckle at your laughably small penis, they just feel sorry for you. Goddess Nikki Brooks and Bella Ink give you masturbation instructions since no other person alive would want to touch that pathetic disgusting little dicklette.
Model:
Bella Ink, Nikki Brooks
Studio:
Clubdom.com
Info:
File Name : cd_s1160_nikkibrooks_bellaink_jerkoffpov.mp4
File Size : 257.82 MB
Resolution : 1280x720
Duration : 00:05:28

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/6e99791e0a8c9 (https://tezfiles.com/file/6e99791e0a8c9)

Naeite
01-19-2022, 05:16 PM
Clubdom.com- StraitJacket Bitch Gets Ass Fucked Hard
https://img165.imagetwist.com/th/44823/834h44cnle9z.jpg (https://imagetwist.com/834h44cnle9z/s572_kendra_alexis_strap_on.jpg)
https://img119.imagetwist.com/th/44823/vb8n09gkuxmj.jpg (https://imagetwist.com/vb8n09gkuxmj/shnCLNo.jpg)

Description:
Mistress Kendra James and Mistress Alexis Grace have had their fun destroying the straight jacketed slaves balls with a game of monkey fist. Now it_s time to stretch out his man pussy. They strap up with a 12 inch black strap on letting the bitch out of his cage to fuck his manhole. Pounding him vigorously over and over laughing while enjoying the control they have over him. He has to learn the consequences of being their bitch. Mistress Kendra flips him over and pile drives his ass even more. This is their favorite past time. Thats right bitch beg for every inch.
Model:
Alexis Grace, Kendra James
Studio:
Clubdom.com
Info:
File Name : s572_kendra_alexis_strap_on.mp4
File Size : 282.24 MB
Resolution : 1280x720
Duration : 00:05:59

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/58b6514a43b58 (https://tezfiles.com/file/58b6514a43b58)

Naeite
01-19-2022, 05:17 PM
Clubdom.com- Michelle_s Pleasure Slave 3: Whipped
https://img202.imagetwist.com/th/45050/85er51b5k5es.jpg (https://imagetwist.com/85er51b5k5es/cd_s1012_3-6_michellelacy_whipping.jpg)
https://img119.imagetwist.com/th/45050/r5h5hwxnqumi.jpg (https://imagetwist.com/r5h5hwxnqumi/iQSpKWBG.jpg)

Description:
Michelle is now going to whip her slave for failing to pleasure her. She already bruised up his cock and not she wants to do the same to his back. Michelle whips her slave while threatening him. If I wasn_t thinking about using you as a human dildo later, I might have taken all of your skin off she says about his cock. Michelle makes the slave suffer with each lash. Then she admires his lashes and with her leather gloved hand, makes him taste her wet pussy.
Model:
Michelle Lacy
Studio:
Clubdom.com
Info:
File Name : cd_s1012_3-6_michellelacy_whipping.mp4
File Size : 258.25 MB
Resolution : 1280x720
Duration : 00:05:27

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/19173b3fad205 (https://tezfiles.com/file/19173b3fad205)

Naeite
01-19-2022, 05:25 PM
Clubdom.com- Russian Revenge - Mini Movie
https://img119.imagetwist.com/th/45070/4ceh33fvaa5k.jpg (https://imagetwist.com/4ceh33fvaa5k/cd_s673_full_russianrevenge.jpg)
https://img202.imagetwist.com/th/45070/7lpyoqw8fgpk.jpg (https://imagetwist.com/7lpyoqw8fgpk/HfGuls.jpg)

Description:
Dava is a sweet girl who met Cameron at a local night club. She thought he was really sweet and really liked him. He told her that she was different and that he had feelings for her. After a little bit of kissing one thing led to another. To Dava, the sex was not that great but she really likes this guy. He promises to call her the next day, however, after weeks he never returns her texts or phone calls. Cameron is a player and only out for hooks up and one night stands with no regard to any of the women_s emotions. Months go by and Dava_s Russian Aunt finds out what was done to her niece. She spots Cameron at a local hang out and uses her thick Russian accent and sexuality to lure Cameron for some fun. She is pulling Cameron into a barn in the middle of nowhere, blindfolded with his arms duck taped together. His clothes are all ripped and torn and throws him into the corner. So you like one night stands? I hear you like to do your thinking with that thing between your legs. Using women then never call and then have any regard for their feelings. I am going to show you what this feels like. Cameron is terrified asking what are you going to do to me Kylie grabs a drill and puts the bit right to his forehead and says maybe we should just put a hole here to correct the problem. But that_s not the head that you_re doing the thinking with now is it? The picks up an old rusty machete spreads his legs and swings the machete down within inches of his tiny little pathetic dicklet. He screams. Goddess Kylie calmly takes a drag of her cigarette. Slowly exhaling the smoke right in the bitches face. She then grabs him and tells him I have something much better for you. Leading him over to where her sister Dava is brandishing a 12 inch black strap on she informs him you are going to participate in one of your favorite activities. Open that bitch slut mouth and suck her cock Dominating him completely and shoving his face down on the cock till he gags they make him beg for Dava to fuck his pathetic man-pussy. After making Cameron suck her huge black strap-on, she instructs the bitch to bend over. Goddess Kylie is going to show him what a real one-night stand is. She pounds his man pussy hard, making him tell her how much he loves getting fucked. Please, please fuck my ass Goddess, Cameron screams. Goddess Kylie fucks the bitch until she wears out his manhole. The bitch is taken out back and put on his knees between the ladies. He tells them how sorry he is for using Dava for a one night stand and that he has learned his lesson. Goddess Kylie grabs him by his chin and informs him he will consider the females feelings from now on, and that he will never use women as sexual toys again. Goddess Kylie instructs him that he will be respectful and treat them like queens. I hope you have learned from this Cameron, he replies yes and says how sorry he is. The ladies laugh. Goddess Kylie holds her machete and says, Now get out of my barn bitch Cameron runs out of the barn screaming like the little sissy bitch he is
Model:
Dava Foxx, Kylie Rogue
Studio:
Clubdom.com
Info:
File Name : cd_s673_full_russianrevenge.mp4
File Size : 555.39 MB
Resolution : 1280x720
Duration : 00:11:43

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/c5f5bb20a5884 (https://tezfiles.com/file/c5f5bb20a5884)

Naeite
01-19-2022, 05:29 PM
Clubdom.com- Ass Worship Jerk
https://img119.imagetwist.com/th/44657/ycqm2dbmw0xe.jpg (https://imagetwist.com/ycqm2dbmw0xe/cd_02_11_13_jerkoff.jpg)
https://img119.imagetwist.com/th/44657/5cc1s2qw67bm.jpg (https://imagetwist.com/5cc1s2qw67bm/cd_02_11_13_jerkoff.mp4.jpg)

Description:
Mistress Charlotte makes her slave_s cock a jerk toy for her amusement while Mistress Coral enjoys a cigarette and watches the action. Charlotte expertly jerks the slave_s cock as he is put to work worshipping her ass. Charlotte makes him explode his cum all over her hand, then force feeds him every drop of his filth from it.
Model:
Charlotte, Coral
Studio:
Clubdom.com
Info:
File Name : cd_02_11_13_jerkoff.mp4
File Size : 50.01 MB
Resolution : 640x360
Duration : 00:06:21

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/076c7bb2228d8 (https://tezfiles.com/file/076c7bb2228d8)

Naeite
01-19-2022, 05:37 PM
Clubdom.com- Mistresses Fuck Slave w Strapon
https://img202.imagetwist.com/th/44743/o3w6ly4dfgnt.jpg (https://imagetwist.com/o3w6ly4dfgnt/s462_strap_on.jpg)
https://img33.imagetwist.com/th/44743/urc6f9xl6v4u.jpg (https://imagetwist.com/urc6f9xl6v4u/s462_strap_on.mp4.jpg)

Description:
Kendra James and Zoey Portland have a male bitch locked tightly into head brace, with his balls locked behind his ass in a humbler. Both of the slut_s love holes are exposed and vulnerable. The ladies completely emasculate this male bitch with there big black cocks. Kendra enjoys watching her dick take the slut_s ass as his pathetic balls are locked behind him. Zoey forces the slut to deep throat her cock, enjoying this bitch_s utter humiliation.
Model:
Kendra James, Zoey Portland
Studio:
Clubdom.com
Info:
File Name : s462_strap_on.mp4
File Size : 237.44 MB
Resolution : 1280x720
Duration : 00:05:01

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/9b2465bdfc112 (https://tezfiles.com/file/9b2465bdfc112)

Naeite
01-19-2022, 05:51 PM
Clubdom.com- Pony Cart Ride Then Strapon Fucking
https://img202.imagetwist.com/th/44745/w44xo6ot9q0u.jpg (https://imagetwist.com/w44xo6ot9q0u/s477_strap_on___cart_vanessa_alexa_riley.jpg)
https://img33.imagetwist.com/th/44745/uld2gf8qzhy0.jpg (https://imagetwist.com/uld2gf8qzhy0/s477_strap_on___cart_vanessa_alexa_riley.mp4.jpg)

Description:
Vanessa and Alexa enjoy a pony cart ride then fuck pathetic guys outside.
Model:
Vanessa Cage
Studio:
Clubdom.com
Info:
File Name : s477_strap_on_pony_cart_vanessa_alexa_riley.mp4
File Size : 265.14 MB
Resolution : 1280x720
Duration : 00:05:33

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/b4542d1901cac (https://tezfiles.com/file/b4542d1901cac)

Naeite
01-19-2022, 05:54 PM
Clubdom.com- Jean Alexis Face Smack
https://img119.imagetwist.com/th/45180/kic9q6a1to9r.jpg (https://imagetwist.com/kic9q6a1to9r/cd_s144_2-5_jean_alexis_facesmack.jpg)
https://img119.imagetwist.com/th/45180/oiylg6aizchv.jpg (https://imagetwist.com/oiylg6aizchv/aqtKGZ.jpg)

Description:
Never Released
Model:
Alexis Grace, Jean Bardot
Studio:
Clubdom.com
Info:
File Name : cd_s144_2-5_jean_alexis_facesmack.mp4
File Size : 114.77 MB
Resolution : 1280x720
Duration : 00:02:25

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/54f1fa65badb6 (https://tezfiles.com/file/54f1fa65badb6)

Naeite
01-19-2022, 06:15 PM
Clubdom.com- Slave To The Queen Qandisa
https://img119.imagetwist.com/th/45051/vfwe7wgyizen.jpg (https://imagetwist.com/vfwe7wgyizen/cd_s1048_qandisa_amadahy_povqueen.jpg)
https://img202.imagetwist.com/th/45051/5v59b5hfghhi.jpg (https://imagetwist.com/5v59b5hfghhi/pbwZsz.jpg)

Description:
Queen Qandisa wants you crawling on your knees like the pathetic and desperate slave you are. You will never be worthy to be worthy enough to worship her body or even her high heels. You can stare and wish But don_t you touch your worthless excuse of a cock unless she allows it. You may worship her with your eyes as you stroke that pathetic cock for your Queen and eat your filth as sacrifice.
Model:
Queen Qandisa
Studio:
Clubdom.com
Info:
File Name : cd_s1048_qandisa_amadahy_povqueen.mp4
File Size : 244.23 MB
Resolution : 1280x720
Duration : 00:05:12

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/1c3e4b7d5ff1f (https://tezfiles.com/file/1c3e4b7d5ff1f)

Naeite
01-19-2022, 06:25 PM
Clubdom.com- Worship Goddess Jamie Valentine_s Ass
https://img119.imagetwist.com/th/44837/efjmk7hv7zrj.jpg (https://imagetwist.com/efjmk7hv7zrj/cds879jaimevalentineassworship.jpg)
https://img119.imagetwist.com/th/44837/dmqw7y3alm6b.jpg (https://imagetwist.com/dmqw7y3alm6b/asqzOQbo.jpg)

Description:
Goddess Jamie Valentine loves dominating men and pulls her slut from his cage just to have some fun with him, She spreads her legs, and her pussy letting him get real close and instructs him to take three deep breaths breathing in her essence she laughs as he trembles being so close to her , Then turns around and shoves his face into her big beautiful ass smothering him and bouncing her ass off his face, she laughs as he has dripped pre-cum all over the ground then puts him back in the cage and makes him thank her for getting to be that close yo her.
Model:
Jamie Valentine
Studio:
Clubdom.com
Info:
File Name : cds879jaimevalentineassworship.mp4
File Size : 272.19 MB
Resolution : 1280x720
Duration : 00:05:46

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/ce4ea499b9e54 (https://tezfiles.com/file/ce4ea499b9e54)

Naeite
01-19-2022, 06:28 PM
Clubdom.com- Please Cane Me
https://img202.imagetwist.com/th/45056/ho11v35cmy8s.jpg (https://imagetwist.com/ho11v35cmy8s/cd_s417_esmilee_januaryseraph_whiping_caing.jpg)
https://img202.imagetwist.com/th/45056/rwy360pta2qe.jpg (https://imagetwist.com/rwy360pta2qe/RoXEuQA.jpg)

Description:
Mistresses January and Esmi decide to play a cruel game with their helpless slave bitch. Knowing that he is terrified of the cane, they decide to whip him instead, promising only to stop when he sincerely begs to be caned The bitch is soon begging to be caned, but the Mistresses continue the whipping until they are convinced he is sincere. Things go from bad to worse as the Mistresses cane the bitch he is soon screaming and shaking helplessly in his chains, much to the delight of the heartless Mistresses. When they have finished with the bitch, they are so hot from his punishment that they make out, leaving him still bound with a cane in his mouth, waiting for further punishment
Model:
Esmi Lee, January Seraph
Studio:
Clubdom.com
Info:
File Name : cd_s417_esmilee_januaryseraph_whiping_caing.mp4
File Size : 379.25 MB
Resolution : 1280x720
Duration : 00:07:59

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/838a4aa3049eb (https://tezfiles.com/file/838a4aa3049eb)

Naeite
01-19-2022, 06:29 PM
Clubdom.com- Michelle Lydia StrapOn Fuck a ManWhore
https://img119.imagetwist.com/th/44834/eyd1h9l6478z.jpg (https://imagetwist.com/eyd1h9l6478z/s700michellelacylydiasupremicystaponwhore.jpg)
https://img119.imagetwist.com/th/44834/pmjazfidhib0.jpg (https://imagetwist.com/pmjazfidhib0/CLOtSNPx.jpg)

Description:
Goddess Lydia Supremacy and Mistress Michelle Lacy look down upon their slave in his cage informing him that it is feeding time at slave farm. As the worthless slave looks up he sees his two Goddesses standing over him with their 12 black strap-on cocks. That_s right bitch, we are feeding you these cocks before we pound that tight man pussy of yours Goddess Lydia informs him. The two Goddesses release this pathetic bitch from his cage and demands that he opens wide for their cocks. Then Mistress Michelle shoves her 12 strap-on down his throat making him gag like a little slut. As he tries gasping for air both Goddesses face fuck their slave with both strap-ons at the same time stretching his mouth as wide as it can get. When Mistress Michelle and Goddess Lydia has had enough face fucking this worthless slave, they bend him over his cage and begin to pound his man pussy into oblivion. As their slave tries to let out a scream for mercy, Goddess Lydia shoves her strap-on down his throat. Now the pathetic bitch has both fuck holes stuffed.
Model:
Lydia Supremacy, Michelle Lacy
Studio:
Clubdom.com
Info:
File Name : s700michellelacylydiasupremicystaponwhore.mp4
File Size : 333.91 MB
Resolution : 1280x720
Duration : 00:07:04

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/00f1e62318483 (https://tezfiles.com/file/00f1e62318483)

Naeite
01-19-2022, 06:31 PM
Clubdom.com- Megan Jones StrapOn Fucks
https://img119.imagetwist.com/th/45180/y1w6p43x6obi.jpg (https://imagetwist.com/y1w6p43x6obi/cd_s190_strap_on.jpg)
https://img119.imagetwist.com/th/45180/2m5d2u5f7ehw.jpg (https://imagetwist.com/2m5d2u5f7ehw/wkjzceh.jpg)

Description:
Never Released
Model:
Megan Jones
Studio:
Clubdom.com
Info:
File Name : cd_s190_strap_on.mp4
File Size : 309.43 MB
Resolution : 1280x720
Duration : 00:06:30

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/1a88f5ce69e5e (https://tezfiles.com/file/1a88f5ce69e5e)

Naeite
01-19-2022, 06:34 PM
Clubdom.com- Rilynn Roxi Wrestling Humiliation 2
https://img202.imagetwist.com/th/44826/lfox6pjes8u5.jpg (https://imagetwist.com/lfox6pjes8u5/s6822-2rilynnraeroxiiblairwrestling.jpg)
https://img69.imagetwist.com/th/44826/bfprh42ba4qh.jpg (https://imagetwist.com/bfprh42ba4qh/RJMlsi.jpg)

Description:
Goddess Roxii Blair and Rilynn Rae notice that the two boys are walking back over to the mats, so they begin to put their plan in action and start to play with each other. While they are making out and feeling each other, tiny dick and tinnier dick come back to grab their jock strap they had forgotten and as they try to walk away the girls stop them. Roxxii and Rilynn tell these losers that they feel sorry for them and want to make it up. With the two boys feeling humiliated by losing earlier they decide to give in and let Roxxii and Rilynn play with their dicks. The girls then pin these little dicks to the floor and begin to make fun of and humiliate their small tiny dicklets. Riylnn points out that he is tiny dick and makes him admit it as they play with their 2 dicks. While the girls are laughing they tower over the two boys and make them jerkoff on their feet and lick it all off every last drop. Making tiny dick and tinnier dick feel even more humiliated and defeated then before.
Model:
Rilynn Rae, Roxii Blair
Studio:
Clubdom.com
Info:
File Name : s6822-2rilynnraeroxiiblairwrestling.mp4
File Size : 336.14 MB
Resolution : 1280x720
Duration : 00:07:08

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/64223e5aa7c2f (https://tezfiles.com/file/64223e5aa7c2f)

Naeite
01-19-2022, 06:34 PM
Clubdom.com- Milking their Pathetic Slave
https://img119.imagetwist.com/th/45060/udd8xuf184fm.jpg (https://imagetwist.com/udd8xuf184fm/cd_s1121_3-4_mistressdahlia_dominahelena_milking.jpg)
https://img202.imagetwist.com/th/45060/npkueyowg4tr.jpg (https://imagetwist.com/npkueyowg4tr/tgIywS.jpg)

Description:
Now that Mistress Dahlia and Domina Helena have whipped and caned their pathetic slave, they want to milk the disgusting filth out of his useless balls. They restrain their slave in their dungeon and start stroking his slut stick to milk out his filth. After he finally spills his filth, they feed it to him as a reward.
Model:
Dahlia Rain, Domina Helena
Studio:
Clubdom.com
Info:
File Name : cd_s1121_3-4_mistressdahlia_dominahelena_milking.mp4
File Size : 213.01 MB
Resolution : 1280x720
Duration : 00:04:32

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/455888fd24a21 (https://tezfiles.com/file/455888fd24a21)

Naeite
01-19-2022, 06:41 PM
Clubdom.com- Dominating Our Balls
https://img33.imagetwist.com/th/44666/20bnben4my6b.jpg (https://imagetwist.com/20bnben4my6b/cd_05_04_13_vibratormilking.jpg)
https://img165.imagetwist.com/th/44666/pjlg4q25a68f.jpg (https://imagetwist.com/pjlg4q25a68f/cd_05_04_13_vibratormilking.mp4.jpg)

Description:
Goddess Amadahy and Mistress Elena love controlling men through their balls because when you have a man by his balls, you completely own him. With his balls locked in a humbler, this bitch has no choice but to grovel on his knees as Amadahy and Elena parade him around, harshly pulling his nuts whenever he does not crawl fast enough for them. They joke about castrating the bitch as they squeeze and slap his pathetic nuts. But the Mistresses come up with a different evil plan - they will force the bitch to cum, regardless of his aching balls, totally ruining his orgasm and causing even more pain

Amadahy sits on the bitch_s chest, teasing him that her wet pussy is just over his chest as she uses the vibrator to get him more and more excited. His balls are so hurt that he can not even achieve an erection, but Amadahy still forces him to cum all over his chest. Amadahy feeds him his filth off of her latex gloved hand as she and Elena laugh at the level of control they have over this pathetic bitch.
Model:
Elena Sin, Goddess Amadahy
Studio:
Clubdom.com
Info:
File Name : cd_05_04_13_vibratormilking.mp4
File Size : 354.58 MB
Resolution : 1280x720
Duration : 00:07:28

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/5005bd0d6e355 (https://tezfiles.com/file/5005bd0d6e355)

Naeite
01-19-2022, 06:41 PM
Clubdom.com- Tiny Dick_s Beatdown Part 1
https://img119.imagetwist.com/th/44719/xl0bmhce8ut3.jpg (https://imagetwist.com/xl0bmhce8ut3/tinydickbeatdown1.jpg)
https://img202.imagetwist.com/th/44719/koz4ca3spb0s.jpg (https://imagetwist.com/koz4ca3spb0s/tinydickbeatdown1.mp4.jpg)

Description:
Alexis Grace and Kendra James are doing there stretches and notice how quiet it is. Kendra asks Alexis about her last experience here at the gym. Alexis Explains how she kicked this wannabe wrestler who they call Tiny Dick_s ass. The Goddess look behind them and see Tiny Dick has just so happen to arrive. Tiny Dick tries to act tough and lets the Goddess_s know he is with his new bad ass partner EL Blanco. Alexis is not intimidated and laughs at Tiny Dick and pulls down his shorts. Kendra and Alexis hysterically laugh at how tiny his dick actually is. Tiny Dick cries that this it is his Matt time and they need to leave. The Goddess come up with a wager that if they can beat them in a match they will leave for good. Tiny Dick and El Blanco are up for the challenge. Before Tiny Dick and El Blanco even gets a chance to put up there guard the Mistress_s attack them. Kendra and Alexis get these losers on the ground and immediately put them in submissions. Alexis and Kendra verbally humiliate these two losers ass they kick there ass all over the Matt. The losers try there hardest to put up a fight but they are no match for these two brutal Goddess_s.
Model:
Alexis Grace, Kendra James
Studio:
Clubdom.com
Info:
File Name : tinydickbeatdown1.mp4
File Size : 224.71 MB
Resolution : 640x360
Duration : 00:07:14

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/6c7f8fa790b5b (https://tezfiles.com/file/6c7f8fa790b5b)

Naeite
01-19-2022, 06:50 PM
Clubdom.com- Brings out the Clothespins
https://img119.imagetwist.com/th/45086/4qqbf9w0s3yr.jpg (https://imagetwist.com/4qqbf9w0s3yr/qnOyZIoI.jpg)
https://img165.imagetwist.com/th/45086/1o6unywqcq01.jpg (https://imagetwist.com/1o6unywqcq01/hoBSCIo.jpg)

Description:
Club Dom features famous Mistresses from around the world engaging in slave training, corporal punishment, ball-busting, CBT, strap-on, and more.
Model:
Teens girls, beautiful girl, milf
Studio:
Clubdom.com
Info:
File Name : Movie502.wmv
File Size : 10.8 MB
Resolution : 320x240
Duration : 00:02:54

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/6336bf88aebf6 (https://tezfiles.com/file/6336bf88aebf6)

Naeite
01-19-2022, 06:50 PM
Clubdom.com- Queens of Ball-Destruction: NEVER WALK AGAIN
https://img202.imagetwist.com/th/45050/nqp404f4mhfo.jpg (https://imagetwist.com/nqp404f4mhfo/cd_s1026_tangent_michellelacy_paulinaamore_ballbus ting.jpg)
https://img119.imagetwist.com/th/45050/d003n3xtnx9l.jpg (https://imagetwist.com/d003n3xtnx9l/aeecVC.jpg)

Description:
Michelle Lacy and Goddess Tangent are QUEENS of ball destruction and are going to make sure their slave_s balls are bruised and destroyed. They prefer to do this, the most fun and destructive way they know how, to kick them in, full-force, as hard as they can The women take turns viciously kicking the slave_s balls in until he is doubled over in pain, sometimes holding him so he doesn_t pass out just yet, while the other woman goes to town bashing them in. They also grab his balls and talk about destroying them and the lovely colors his damaged flesh is turning for them. He will NEVER WALK AGAIN.
Model:
Goddess Tangent, Michelle Lacy
Studio:
Clubdom.com
Info:
File Name : cd_s1026_tangent_michellelacy_paulinaamore_ballbus ting.mp4
File Size : 411.75 MB
Resolution : 1280x720
Duration : 00:08:42

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/157b618fc1bf5 (https://tezfiles.com/file/157b618fc1bf5)

Naeite
01-19-2022, 07:00 PM
Clubdom.com- Arena StrapOn Fucks his Man-Pussy
https://img202.imagetwist.com/th/45058/8hflua4bpyva.jpg (https://imagetwist.com/8hflua4bpyva/cd_s1110_5-5_arenarome_strapon.jpg)
https://img119.imagetwist.com/th/45058/4597as79h1jf.jpg (https://imagetwist.com/4597as79h1jf/WiDyZUu.jpg)

Description:
Queen Arena Rome makes her slave lube up her strap on before she fucks his tight man pussy. When her big black cock is lubed up enough, Queen Arena bends her slave over and shoves her cock in his ass.
Model:
Arena Rome
Studio:
Clubdom.com
Info:
File Name : cd_s1110_5-5_arenarome_strapon.mp4
File Size : 296.28 MB
Resolution : 1280x720
Duration : 00:06:17

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/21e32b6fe4dc3 (https://tezfiles.com/file/21e32b6fe4dc3)

Naeite
01-19-2022, 07:02 PM
Clubdom.com- Cum For Black Cocks
https://img119.imagetwist.com/th/45063/34lkvqs4bp4o.jpg (https://imagetwist.com/34lkvqs4bp4o/cd_s1162_nikkibrooks_bellaink_straponpov.jpg)
https://img119.imagetwist.com/th/45063/nrxu8epqhlbe.jpg (https://imagetwist.com/nrxu8epqhlbe/xJIdCrN.jpg)

Description:
Goddess Nikki Brooks and Goddess Bella Ink approach your worthless ass stuck in your cage wearing leather corsets, thigh high boots and big black cocks. They stand over you, looking down at you, stroking their massive strap on cocks, teasing you with them. Nikki Brooks and Bella Ink know you really really want to feel their cocks in your mouth and your whore ass. They want you to see what having a real cock is like, not just that pathetic tiny dicklette you have between your legs.
Model:
Bella Ink, Nikki Brooks
Studio:
Clubdom.com
Info:
File Name : cd_s1162_nikkibrooks_bellaink_straponpov.mp4
File Size : 238.45 MB
Resolution : 1280x720
Duration : 00:05:01

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/1807ef251739f (https://tezfiles.com/file/1807ef251739f)

Naeite
01-19-2022, 07:02 PM
Clubdom.com- Sarah Dise: Penetrating Your Ass Bitch
https://img119.imagetwist.com/th/44836/g43knkg41rvr.jpg (https://imagetwist.com/g43knkg41rvr/s871sarahdicestraponlew.jpg)
https://img69.imagetwist.com/th/44836/ph8boh3j4gft.jpg (https://imagetwist.com/ph8boh3j4gft/aGZBJxIa.jpg)

Description:
Goddess Sarah Dise loves to stretch out gaping assholes she makes her slave lube up her cock with only his spit.The penetrates him and rams his man pussy hard. he begs for every inch and goddess gives it to him hard.
Model:
Sarah Dise
Studio:
Clubdom.com
Info:
File Name : s871sarahdicestraponlew.mp4
File Size : 272.82 MB
Resolution : 1280x720
Duration : 00:05:46

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/0638337fcd833 (https://tezfiles.com/file/0638337fcd833)

Naeite
01-19-2022, 07:05 PM
Clubdom.com- Whipping Day with Harlow and Dahlia
https://img202.imagetwist.com/th/45052/33g9didzxsmp.jpg (https://imagetwist.com/33g9didzxsmp/cd_s1061_dahliaharlow_whip.jpg)
https://img202.imagetwist.com/th/45052/bttlp4rzor0y.jpg (https://imagetwist.com/bttlp4rzor0y/vTVdSo.jpg)

Description:
Goddess Harlow and Goddess Dahlia have their slave strung up for a whipping. It is whipping day, and they have chosen this slave to be shredded by their vicious whips. You are really going to get it says Dahlia, smiling with sadistic glee. The women take turns shredding their slave_s back with their whips, mocking him and treating him like the piece of meat that he is. It_s the only way to keep their slaves in line, they all must be regularly whipped on whipping day.
Model:
Dahlia Rain, Harlow Harrison
Studio:
Clubdom.com
Info:
File Name : cd_s1061_dahliaharlow_whip.mp4
File Size : 372.92 MB
Resolution : 1280x720
Duration : 00:07:53

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/6fbef1feca1d0 (https://tezfiles.com/file/6fbef1feca1d0)

Naeite
01-19-2022, 07:13 PM
Clubdom.com- Fucked Dick Hole MILKING
https://img202.imagetwist.com/th/45078/dk302twdaaao.jpg (https://imagetwist.com/dk302twdaaao/cd_s1286_nadiawhite_valora_sounding.jpg)
https://img202.imagetwist.com/th/45078/u9wx4a5rijil.jpg (https://imagetwist.com/u9wx4a5rijil/GDWVNf.jpg)

Description:
Nadia White and Goddess Valora are really tormenting their captive slave. He is bound down to a table and it_s MILKING DAY The slave is going to be milked, but he is going to suffer for it by having his dick hole invaded by sounding rods. The women fuck his dick hole and laugh as he tries hard to cum but simply cannot, yet stays on the edge under their control. Finally he is able to release but it is so unbearable for him
Model:
Goddess Valora, Nadia White
Studio:
Clubdom.com
Info:
File Name : cd_s1286_nadiawhite_valora_sounding.mp4
File Size : 268.74 MB
Resolution : 1280x720
Duration : 00:05:39

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/bd83e720267a6 (https://tezfiles.com/file/bd83e720267a6)

Naeite
01-19-2022, 07:21 PM
Clubdom.com- Fur Goddesses Sunbathing Ass Worship
https://img119.imagetwist.com/th/45043/8riz0yrc4sm1.jpg (https://imagetwist.com/8riz0yrc4sm1/s907nataliastarrparisknightmichellelacyassworship. jpg)
https://img119.imagetwist.com/th/45043/w8001na3sfs8.jpg (https://imagetwist.com/w8001na3sfs8/eoBGxU.jpg)

Description:
After having their feet worshipped, Mistresses Natalia and Paris order their slave to worship their asses. When they have had enough, Natalia shoves the slave into the pool and orders him to stay there until they allow him to get out.
Model:
Natalia Starr, Paris Knight
Studio:
Clubdom.com
Info:
File Name : s907nataliastarrparisknightmichellelacyassworship. mp4
File Size : 262.76 MB
Resolution : 1280x720
Duration : 00:05:29

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/b93a745a67c39 (https://tezfiles.com/file/b93a745a67c39)

Naeite
01-19-2022, 07:21 PM
Clubdom.com- Caught by the Guardesses Part 1: Whipping
https://img202.imagetwist.com/th/45046/2x9qm4z2zl53.jpg (https://imagetwist.com/2x9qm4z2zl53/cd_s955_1-4_jamievalentine_paris_whippingbitch.jpg)
https://img202.imagetwist.com/th/45046/gazlqpepn6u6.jpg (https://imagetwist.com/gazlqpepn6u6/OdZJTw.jpg)

Description:
The Guardesses Paris and Jamie catch this man spying on them. He had been hiding on the side of the compound when a slave saw and reported him to the Mistresses. Paris kicks out the block he was standing on to make the spy dangle helplessly. Jaime and Paris both begin interrogating him, using their whips to make him talk. They will soon break him.
Model:
Jamie Valentine, Paris Knight
Studio:
Clubdom.com
Info:
File Name : cd_s955_1-4_jamievalentine_paris_whippingbitch.mp4
File Size : 388.29 MB
Resolution : 1280x720
Duration : 00:07:09

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/e03c7ec6e637e (https://tezfiles.com/file/e03c7ec6e637e)

Naeite
01-19-2022, 07:22 PM
Clubdom.com- Goddess Tangent: Suffer for the Whip
https://img119.imagetwist.com/th/45179/d4rg1oy4wo0h.jpg (https://imagetwist.com/d4rg1oy4wo0h/cd_s1324_tangent_whipping.jpg)
https://img119.imagetwist.com/th/45179/a9u582nxuiyl.jpg (https://imagetwist.com/a9u582nxuiyl/qkDllIG.jpg)

Description:
Goddess Tangent is a dangerous woman, put a whip in her hand, and she is lethal. She beckons her slave over and lays the rules down. She doesnt want him to scream or tap out, she wants to have fun, in her words, she wants to flay him. Not a Goddess to go back on her word, she has her slave restrained, completely and utterly at her mercy. She repeatedly whips him, of course without mercy. This slave is overwhelmed with pain, you can hear it in his screams and his labored breathing. Try as may, he desires nothing more than to please his Goddess. Pleasing Goddess Tangent is not easy, not for the weak. Only the strongest, most dedicated and enduring pain slaves will please her. This video is a glimpse into what it takes to be a pain slave for Goddess Tangent. This slave suffers, and so will you
Model:
Goddess Tangent
Studio:
Clubdom.com
Info:
File Name : cd_s1324_tangent_whipping.mp4
File Size : 331.93 MB
Resolution : 1280x720
Duration : 00:07:00

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/f3d4b17dbc4cf (https://tezfiles.com/file/f3d4b17dbc4cf)

Naeite
01-19-2022, 07:25 PM
Clubdom.com- Michelle Lacy Tangent Boot Worship
https://img202.imagetwist.com/th/45045/eu2975bexrs7.jpg (https://imagetwist.com/eu2975bexrs7/s937michellelacygoddesstangentbootworship.jpg)
https://img202.imagetwist.com/th/45045/r1bprph2o6rp.jpg (https://imagetwist.com/r1bprph2o6rp/PFvNJfi.jpg)

Description:
The She-Gods decide they are not done with their little _. It_s time for these bitches to lick their boots clean. They stroke their cocks and laugh as each slave has to lick the filth from their boots. Goddess Tangent even spits on her boots for her slave to lick off. He_s so pathetic Mistress Michelle and Natasha just keep laughing and instructing their slaves and shoving their heels into their slave_s mouth holes until everything is nice and clean.
Model:
Goddess Tangent, Michelle Lacy
Studio:
Clubdom.com
Info:
File Name : s937michellelacygoddesstangentbootworship.mp4
File Size : 375.63 MB
Resolution : 1280x720
Duration : 00:06:55

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/6036689e726af (https://tezfiles.com/file/6036689e726af)

Naeite
01-19-2022, 07:26 PM
Clubdom.com- Dahila_s Pathetic Bitch Slave
https://img119.imagetwist.com/th/45054/wty0pbhvqi01.jpg (https://imagetwist.com/wty0pbhvqi01/cd_s1090_1-3_dahliarain_lydiasupremacy_caning.jpg)
https://img119.imagetwist.com/th/45054/4ihglnmv3n4h.jpg (https://imagetwist.com/4ihglnmv3n4h/JzIoiia.jpg)

Description:
Goddess Dahlia Rain wants to play with one of her pathetic bitch slaves. She pulls him out of his cage and shocks his pathetic body with a cattle prod. When Goddess Dahlia thinks he is tenderized enough, she has her slave bend over her whipping horse and starts caning his pale ass. Goddess Dahlia wants her slave to lose his mind with her beatings that he can_t count how many times he_s been caned.
Model:
Dahlia Rain
Studio:
Clubdom.com
Info:
File Name : cd_s1090_1-3_dahliarain_lydiasupremacy_caning.mp4
File Size : 276.91 MB
Resolution : 1280x720
Duration : 00:05:55

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/9a0adcdd9209e (https://tezfiles.com/file/9a0adcdd9209e)

Naeite
01-19-2022, 07:29 PM
Clubdom.com- Fuck My Boy Pussy Brat Dom
https://img202.imagetwist.com/th/44829/wm4gvh761lxe.jpg (https://imagetwist.com/wm4gvh761lxe/s7693-3annaleebratstrapon.jpg)
https://img119.imagetwist.com/th/44829/v3604fdp3i00.jpg (https://imagetwist.com/v3604fdp3i00/ByFSpb.jpg)

Description:
Bratty Dom Anna Lee has had to satisfy herself And now is strapped up with a thick 10 inch cock and ready to spread and gape some boy pussy. Bratty Dom Anna makes her slut puppy suck and deep throat her hard cock, Gagging and spitting all over it as she makes him beg her to Fuck his boy pussy&lt She smacks his face and bends him over the fuck horse and spreads that tight little boy cunt and rams and fucks him hard until he begs for mercy.
Model:
Anna Lee
Studio:
Clubdom.com
Info:
File Name : s7693-3annaleebratstrapon.mp4
File Size : 278.15 MB
Resolution : 1280x720
Duration : 00:05:53

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/dd024d43cb1ab (https://tezfiles.com/file/dd024d43cb1ab)

Naeite
01-19-2022, 07:37 PM
Clubdom.com- Hungry For Cock
https://img119.imagetwist.com/th/44668/up9enzt4p8yn.jpg (https://imagetwist.com/up9enzt4p8yn/strapmich.jpg)
https://img33.imagetwist.com/th/44668/6cb7ssraia2g.jpg (https://imagetwist.com/6cb7ssraia2g/strapmich.mp4.jpg)

Description:
The Mistress_s slave is hungry for cock and their going to feed it to him though his mouth and man pussy. The Mistresses make him suck on there big black cocks. The Mistresses Shove there cocks deep in his mouth and can care less if he chokes on them. After a good cock sucking its time to fuck this loser raw. The Mistresses bend the slave over and take turns ravishing his defenseless asshole. The Mistress pound his ass till he cannot take it anymore then pound some more. The Mistresses don_t stop there assault on the slaves asshole till they feel like it.
Model:
Macy Cartel
Studio:
Clubdom.com
Info:
File Name : strapmich.mp4
File Size : 155.67 MB
Resolution : 640x360
Duration : 00:06:58

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/b844e492a0725 (https://tezfiles.com/file/b844e492a0725)

Naeite
01-19-2022, 07:44 PM
Clubdom.com- Esmi Lee January POV Masturbation
https://img202.imagetwist.com/th/45070/4a1t4ypqew6v.jpg (https://imagetwist.com/4a1t4ypqew6v/cd_s416_esmilee_januaryseraph_pov.jpg)
https://img119.imagetwist.com/th/45070/s6z2e2w32x9v.jpg (https://imagetwist.com/s6z2e2w32x9v/AbPFkmoL.jpg)

Description:
Goddess Esmi and Goddess January Seraph are here to control you. You will stroke your tiny dick the way they tell you to. How does it feel to have no control over your own manhood? These women have you now, and you must show them what a good obedient bitch you are and do as they ask. Spill that slave slime and lick it all up
Model:
Esmi Lee, January Seraph
Studio:
Clubdom.com
Info:
File Name : cd_s416_esmilee_januaryseraph_pov.mp4
File Size : 297.53 MB
Resolution : 1280x720
Duration : 00:06:15

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/79aeb0fb06776 (https://tezfiles.com/file/79aeb0fb06776)

Naeite
01-19-2022, 07:46 PM
Clubdom.com- Goddess Dava Has 12" For You (POV)
https://img119.imagetwist.com/th/44831/oqx7fd3p28x3.jpg (https://imagetwist.com/oqx7fd3p28x3/s776davafoxxstraponpov.jpg)
https://img119.imagetwist.com/th/44831/dh9r32nr2zjg.jpg (https://imagetwist.com/dh9r32nr2zjg/NuRacz.jpg)

Description:
Goddess Dava Foxx Has 12 inches of hard black cock for your slutty ass, She teases you in your cage then lets you out, So you can wrap your cock hungry mouth around her slut stick, She instructs you to slobber all over it before she rams it up your pathetic slave ass, And fucks you till you cum all over the floor and beg her to lick it up.
Model:
Dava Foxx
Studio:
Clubdom.com
Info:
File Name : s776davafoxxstraponpov.mp4
File Size : 331.97 MB
Resolution : 1280x720
Duration : 00:06:59

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/f6b5a66dca9da (https://tezfiles.com/file/f6b5a66dca9da)

Naeite
01-19-2022, 07:56 PM
Clubdom.com- Bet Your Ass (Wrestling)
https://img165.imagetwist.com/th/44663/ewhih12vrogq.jpg (https://imagetwist.com/ewhih12vrogq/cd_04_20_13_wrestling.jpg)
https://img202.imagetwist.com/th/44663/f7nty3db6pil.jpg (https://imagetwist.com/f7nty3db6pil/cd_04_20_13_wrestling.mp4.jpg)

Description:
When Alexis and Macy confront a sexist jerk at the gym, they bet him that, if he can defeat them in a wrestling match, they will fuck him - but if they defeat him, then they get to fuck him - however they want. The jerk is in for quite a surprise, as the girls completely dominate him on the mat and make him tap out again and again.
Model:
Alexis Grace, Macy Cartel
Studio:
Clubdom.com
Info:
File Name : cd_04_20_13_wrestling.mp4
File Size : 351.08 MB
Resolution : 1280x720
Duration : 00:07:30

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/baf06dc6ec6db (https://tezfiles.com/file/baf06dc6ec6db)

Naeite
01-19-2022, 08:11 PM
Clubdom.com- A Good Use for Balls 1
https://img202.imagetwist.com/th/45171/h15gdru5x08b.jpg (https://imagetwist.com/h15gdru5x08b/movie278cfs.jpg)
https://img119.imagetwist.com/th/45171/cqng26mc89f5.jpg (https://imagetwist.com/cqng26mc89f5/JcabFC.jpg)

Description:
Lady Cheyenne and Mistress Coral muse over a good use for a man_s cock and balls. They squeeze and pinch their slave_s balls and talk about how much they_d like to pop them. Coral twists the slave_s cock and reveals a shocking fantasy. Cheyenne laughs and grabs the slave_s balls, squeezing them until they turn deep purple. The ladies then take turns punching the slave_s helpless ball sac with direct, brute blows.
Model:
Coral
Studio:
Clubdom.com
Info:
File Name : movie278cfs.mp4
File Size : 75.52 MB
Resolution : 640x480
Duration : 00:06:22

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/2a4d70da26c11 (https://tezfiles.com/file/2a4d70da26c11)

Naeite
01-19-2022, 08:17 PM
Clubdom.com- Stella Liberty Slaps Her Bitch
https://img119.imagetwist.com/th/45085/n20aawkcpwbu.jpg (https://imagetwist.com/n20aawkcpwbu/cd_s1297_stellaliberty_faceslapping.jpg)
https://img119.imagetwist.com/th/45085/pyu0m8kfqtvz.jpg (https://imagetwist.com/pyu0m8kfqtvz/IEpYwtj.jpg)

Description:
Stella Liberty and her two potential slaves have moved outdoors, to the beautiful indoor pool. While toiling away for their Mistress, Stella decides that it is now time to test the sissy slave. Dragging him to the dungeon, her quest to test his worthiness begins with a simple questionWhat can you do for me as my slave? Of course, Stella is not satisfied with his textbook answer and explains that she is longer for something much different. Stella, knowing this sissy slave would crumble under her harsh treatment slowly toys with her prey, using him as a spittoon and slapping his face. She literally takes her gloves off, and works this sissy over.
Model:
Stella Liberty
Studio:
Clubdom.com
Info:
File Name : cd_s1297_stellaliberty_faceslapping.mp4
File Size : 305.4 MB
Resolution : 1280x720
Duration : 00:06:29

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/b3398c9aeec5e (https://tezfiles.com/file/b3398c9aeec5e)

Naeite
01-19-2022, 08:36 PM
Clubdom.com- Busted Pool Boy
https://img33.imagetwist.com/th/44663/6t9i3cqd417b.jpg (https://imagetwist.com/6t9i3cqd417b/cd_04_06_13_ballbusting.jpg)
https://img119.imagetwist.com/th/44663/3ngtsd0l9vzu.jpg (https://imagetwist.com/3ngtsd0l9vzu/cd_04_06_13_ballbusting.mp4.jpg)

Description:
Mistresses Kendra and Esmi are furious with this stable slave for failing to clean their pool properly. They order him to stop and present his balls for punishment.

The two Mistresses take turns delivering full force leg kicks to the slave_s nuts, busting him until he has trouble standing up. Kendra is disgusted by his lack of ball pain tolerance, delivering vicious punches right to his balls until he falls over again. After some more ball kicking, Esmi finishes him off with a series of knees to the nuts, then pushes him into the pool. Maybe now the bitch will clean their pool properly.
Model:
Esmi Lee, Kendra James
Studio:
Clubdom.com
Info:
File Name : cd_04_06_13_ballbusting.mp4
File Size : 303.87 MB
Resolution : 1280x720
Duration : 00:06:23

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/4a38003fd6539 (https://tezfiles.com/file/4a38003fd6539)

Naeite
01-19-2022, 08:44 PM
Clubdom.com- Kendra Charlyse Caning Outside
https://img119.imagetwist.com/th/44744/yevonm0wd8cm.jpg (https://imagetwist.com/yevonm0wd8cm/caningkendracharlyse.jpg)
https://img119.imagetwist.com/th/44744/ndd9o5inj2ri.jpg (https://imagetwist.com/ndd9o5inj2ri/caningkendracharlyse.mp4.jpg)

Description:
Kendra James and Goddess Charlyese have their male bitch an a precarious position. His raw ass is completely exposed as they begin a round of repeated and vicious cane strokes. The slut trembles and cries out as the ladies take their sadistic desires out on his helpless ass. Then they put the slut on his feet, bend him over and fire off yet another cruel round..
Model:
Charlyse Angel, Kendra James
Studio:
Clubdom.com
Info:
File Name : caningkendracharlyse.mp4
File Size : 258.81 MB
Resolution : 1280x720
Duration : 00:07:06

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/cd8cec120364e (https://tezfiles.com/file/cd8cec120364e)

Naeite
01-19-2022, 08:45 PM
Clubdom.com- Jewell and Tangent Double Stuff the Ass Slave
https://img119.imagetwist.com/th/45181/hmnxtopbslau.jpg (https://imagetwist.com/hmnxtopbslau/cd_s1346_tangent_jewellmarceau_strapongaby.jpg)
https://img202.imagetwist.com/th/45181/k94msyruo3ez.jpg (https://imagetwist.com/k94msyruo3ez/PUFRnbOs.jpg)

Description:
Now its time for the _ reward But first the Ladies decide that his slutty mouth needs to be stretched like they already stretched his slutty asshole. Goddess Tangent and Mistress Jewell take turns fucking the _ mouth. Their huge cocks stretch his lips and they force their strap ons deep into his throat. The ass slave gags, chokes and cries at the delight of the Ladies. They even try to stuff his mouth with both of their huge cocks together. Now we find out why they stretched this _ ass so wide earlier. Tangent and Jewell are fucking their bitch in the ass at the same time Goddess Tangent is straddling the slaves back while fucking his ass, while Mistress Jewell is behind the slut standing and pounding his sluthole. They fuck the slut relentlessly, laughing with joy, as the slave cries in pain, hugging the spanking bench that he is on. Goddess Tangent finishes the slut off from behind as Mistress Jewell is in front of him forcing him to suck her cock. The lesson learned by the ass slave today? Be careful what you wish for
Model:
Goddess Tangent, Jewell Marceau
Studio:
Clubdom.com
Info:
File Name : cd_s1346_tangent_jewellmarceau_strapongaby.mp4
File Size : 397.68 MB
Resolution : 1280x720
Duration : 00:08:28

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/2dab92236050b (https://tezfiles.com/file/2dab92236050b)

Naeite
01-19-2022, 08:55 PM
Clubdom.com- Miss Ropers Dungeon Slave: Dildo Gagged
https://img202.imagetwist.com/th/45186/l0fpdo1esxs0.jpg (https://imagetwist.com/l0fpdo1esxs0/cd_s1365_raquelroper_chindo.jpg)
https://img119.imagetwist.com/th/45186/7kbafg946bvw.jpg (https://imagetwist.com/7kbafg946bvw/gibzil.jpg)

Description:
Miss Roper has her slave in the dungeon on his knees. After dishing out some corporal punishment with her whip and cane, she now decides its time to tease her slave with her perfect body. Her slaves cock is already rock hard. Miss Roper wants to keep his cock hard so she teases him by unzipping her latex body suit revealing her gorgeous breasts. She then sticks her round bubble butt right in his pathetic face to further his torment. Poor guy is so close but is not allowed to touch her perfect body. Miss Roper spreads her legs and forces her bitch to watch as she pulls her latex to the side and begins to rub her pussy in front of him. You can tell how badly this slave wants his Goddess. He would love to fuck her with his now completely rock-hard cock but Miss Roper informs her bitch that he will be fucking her pussy, but not with his cock. Miss Roper shows him the dildo gag and tells him that he will be rewarded now by being allowed to please her by fucking her with a chindo. The cock gag is attached to the bitchs face and he pleases his Goddess by giving her an orgasm with the chindo. Miss Roper lays back and moans in delight as the dildo goes in and out of her wet pussy. After cumming, Miss Roper gets up abruptly and slaps her slaves face, telling him that he has served his purpose with this dick on his face. She is laughing with a devilish grin, I think Miss Roper has more in store for this bitch
Model:
Miss Roper
Studio:
Clubdom.com
Info:
File Name : cd_s1365_raquelroper_chindo.mp4
File Size : 270.56 MB
Resolution : 1280x720
Duration : 00:05:42

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/3eab465fd42f2 (https://tezfiles.com/file/3eab465fd42f2)

Naeite
01-19-2022, 09:01 PM
Clubdom.com- Beg for Her Cane S216
https://img119.imagetwist.com/th/44821/3rudgn505nyo.jpg (https://imagetwist.com/3rudgn505nyo/begforhercane.jpg)
https://img119.imagetwist.com/th/44821/j3fepw82vqui.jpg (https://imagetwist.com/j3fepw82vqui/HfBktAqu.jpg)

Description:
Mistress Evita knows no mercy. She is particularly when breaking in a new bitch. When the bitch begins to cry, Evita demands that he beg for more cane strokes. She cane the bitch harder with every bit of weakness he shows. Evita enjoys her bitch_s suffering. When she has had her fill she lead the slut back to his cage by his balls.
Model:
Evita Pozzi
Studio:
Clubdom.com
Info:
File Name : begforhercane.mp4
File Size : 37.37 MB
Resolution : 640x360
Duration : 00:04:36

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/43838dc647230 (https://tezfiles.com/file/43838dc647230)

Naeite
01-19-2022, 09:14 PM
Clubdom.com- Lydia Strapon Fucks Loser
https://img202.imagetwist.com/th/45054/wsqc02zmut0u.jpg (https://imagetwist.com/wsqc02zmut0u/cd_s1093_dahliarain_lydiasupremacy_strapon.jpg)
https://img119.imagetwist.com/th/45054/a8s4i7tyedag.jpg (https://imagetwist.com/a8s4i7tyedag/kbjZqmC.jpg)

Description:
Goddess Lydia Supremacy tells her filthy slave that his goal in life is to make her dick happy. She forces her black cock in his wet mouth as he makes slutty noises while sucking her dick. Goddess Lydia wants to fuck his man pussy and bends his eager slave ass over and shoves her big black strap on cock in his slut hole. Goddess Lydia loves how he eagerly fuck back on her cock, but that doesn_t mean she takes it easy on her pathetic slave_s ass.
Model:
Lydia Supremacy
Studio:
Clubdom.com
Info:
File Name : cd_s1093_dahliarain_lydiasupremacy_strapon.mp4
File Size : 271.88 MB
Resolution : 1280x720
Duration : 00:05:45

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/5957b19f97702 (https://tezfiles.com/file/5957b19f97702)

Naeite
01-19-2022, 09:43 PM
Clubdom.com- Dahlia Ass Torments Whipping
https://img202.imagetwist.com/th/45054/xlqgv8zxa3u7.jpg (https://imagetwist.com/xlqgv8zxa3u7/cd_s1090_2-3_dahliarain_lydiasupremacy_whipping.jpg)
https://img202.imagetwist.com/th/45054/3795uikgp0xg.jpg (https://imagetwist.com/3795uikgp0xg/gdbaMlGE.jpg)

Description:
Goddess Dahlia Rain is breaking in her new slave and starts teasing him by forcing him to worship her round ass and wet Goddess pussy so he knows what he_s missing out on. Goddess Dahlia then chains him up so she can whip his white skin bright red. Goddess Dahlia rewards the great work by her pathetic slave by allowing him a taste of her pussy from her fingers.
Model:
Dahlia Rain
Studio:
Clubdom.com
Info:
File Name : cd_s1090_2-3_dahliarain_lydiasupremacy_whipping.mp4
File Size : 314.17 MB
Resolution : 1280x720
Duration : 00:06:42

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/bf429f5322a59 (https://tezfiles.com/file/bf429f5322a59)

Naeite
01-19-2022, 09:45 PM
Clubdom.com- Natasha Natalia Strapon Fucking
https://img202.imagetwist.com/th/44823/qtjohzym4trq.jpg (https://imagetwist.com/qtjohzym4trq/s580_natasha_natalia.jpg)
https://img119.imagetwist.com/th/44823/wi57irp37w9m.jpg (https://imagetwist.com/wi57irp37w9m/pJcIJGwH.jpg)

Description:
Goddess Natalia Starr and Mistress Natasha Starr lube their big black cocks with their slaves spit. They stroke their huge black cocks as the size up their virgin slave. Oh he_s getting fucked for the first time, hard and from both ends. The ladies tag team their slave, fucking his ass and mouth with their 10_ black strap ons . Goddess Natalia slaps the bitch in his face with her cock and makes him beg Mistress Natasha to fuck his ass harder. Then she picks up the slave_s head and makes him watch as she spits long and slow on her cock. She forces her cock into the slaves mouth as Mistress Natasha pounds his ass with 10 hard inches. You are going to start craving big black cock after this, Mistress Natasha laughs, However humiliating it may be, once you_ve had a taste, you_ll need it all the time even begging us for it.
Model:
Natalia Starr, Natasha Starr
Studio:
Clubdom.com
Info:
File Name : s580_natasha_natalia.mp4
File Size : 257.78 MB
Resolution : 1280x720
Duration : 00:05:29

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/6a34b07436ab4 (https://tezfiles.com/file/6a34b07436ab4)

Naeite
01-19-2022, 10:05 PM
Clubdom.com- Rilynn Roxi Wrestling Humiliation
https://img165.imagetwist.com/th/44826/nzn8fng1eezq.jpg (https://imagetwist.com/nzn8fng1eezq/s6821-2rilynnraeroxiiblairwrestling.jpg)
https://img165.imagetwist.com/th/44826/m8z07row72by.jpg (https://imagetwist.com/m8z07row72by/XbUrgb.jpg)

Description:
Tiny Dick and his friend Tinnier Dick are on the mat training for a new wrestling competition. Being pathetic and horrible at it, but they have their new masks and think they are the shit. Goddess Roxii Blair and Rilynn Rae come to work out too. The boys tell them that women have no place on the mat and that they_re going to become the new wrestling stars. The girls claim that they are here to work out for the trial also and it_s their time to use the mat. Rilynn recognises tiny dick your tiny dick he says, no I_m not, he is It is hard to tell because both boys have tiny dicks. As a challenge, the ladies want a wrestling match and whoever wins gets to use the mat. Of course, these boys are pathetic and the women beat them easily. Locking their heads between their legs, rubbing their pussies in their face and teasing them by pulling down their pants making fun of their tiny pathetic dicks. What is that? The boys walk away in shame as girls start to feel sorry for them and devise a plan.
Model:
Rilynn Rae, Roxii Blair
Studio:
Clubdom.com
Info:
File Name : s6821-2rilynnraeroxiiblairwrestling.mp4
File Size : 299.09 MB
Resolution : 1280x720
Duration : 00:06:24

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/9ac735b67e0f2 (https://tezfiles.com/file/9ac735b67e0f2)

Naeite
01-19-2022, 10:33 PM
Clubdom.com- Orgasms Are For Mistresses
https://img119.imagetwist.com/th/44666/vtvqdk2z52km.jpg (https://imagetwist.com/vtvqdk2z52km/cd_06_05_13_femdomsex.jpg)
https://img119.imagetwist.com/th/44666/lo4zjx1cm9m2.jpg (https://imagetwist.com/lo4zjx1cm9m2/cd_06_05_13_femdomsex.mp4.jpg)

Description:
Mistresses Callie and Mena love using sex slaves for their pleasure. The Mistresses toy with the slave_s cock and balls, jerking and slapping them, letting him know that he had better satisfy them both or he might be losing his balls

Mena rides the bitch first, enjoying being pleasured while ordering the bitch to work harder. Callie then takes her turn, fucking the slave until she enjoys a strong orgasm as well. The Mistresses then ask the bitch if he wants a hand job of course, he begs the Mistresses for this privilege. They jerk his cock right until he is about to cum, then clamp down on his cock, making sure that he can not cum. The Mistresses just laugh at his suffering.
Model:
Callie Calypso, Mena Li
Studio:
Clubdom.com
Info:
File Name : cd_06_05_13_femdomsex.mp4
File Size : 60.81 MB
Resolution : 640x360
Duration : 00:06:23

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/aab1f17a999b6 (https://tezfiles.com/file/aab1f17a999b6)

Naeite
01-19-2022, 10:48 PM
Clubdom.com- Esmi Lee January Handjob
https://img119.imagetwist.com/th/45074/26v5p8i4011c.jpg (https://imagetwist.com/26v5p8i4011c/cd_s415_esmilee_januaryseraph_hj.jpg)
https://img119.imagetwist.com/th/45074/cm9iih8br2n5.jpg (https://imagetwist.com/cm9iih8br2n5/bmEvYe.jpg)

Description:
Never Released
Model:
Esmi Lee, January Seraph
Studio:
Clubdom.com
Info:
File Name : cd_s415_esmilee_januaryseraph_hj.mp4
File Size : 299.66 MB
Resolution : 1280x720
Duration : 00:06:20

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/59cd63c36501e (https://tezfiles.com/file/59cd63c36501e)

Naeite
01-19-2022, 10:56 PM
Clubdom.com- Kendra Punishes Her Slave: Caning
https://img202.imagetwist.com/th/45181/z57jft15pngu.jpg (https://imagetwist.com/z57jft15pngu/cd_1306_kendrajames_caning.jpg)
https://img202.imagetwist.com/th/45181/hgz403tyhqt1.jpg (https://imagetwist.com/hgz403tyhqt1/MahYzCE.jpg)

Description:
Goddess Kendra now has her bitch outside by the barn. She is leading him by a leash attached to a humbler that is squeezing his already swollen balls. He has to crawl backwards on his hands and knees fast enough to avoid the pain that the humbler is causing his balls. Goddess Kendra begins beating the slaves balls with her leather gloved covered hands while pulling on the humbler. She is sitting on the slaves back telling him that his punishment is only going to get worse. Kendra then puts the bitch on the wooden caning barrel and makes him kiss her cane before the next stage of his punishment begins. Still locked in the humbler, the slave is beaten mercilessly and severely with the cane. Goddess Kendra takes a break to admire the slaves ass covered completely with welts and cane marks. She tells her bitch that she isnt finished yet The marks are nice and red but she prefers the color purple. She continues to cane the slave even harder than before. She makes the slave beg her to continue the beating even though its clear that he has had enough. This slave is finding out that this punishment will only stop when Kendra has had enough.
Model:
Kendra James
Studio:
Clubdom.com
Info:
File Name : cd_1306_kendrajames_caning.mp4
File Size : 335.82 MB
Resolution : 1280x720
Duration : 00:07:04

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/601738e5754a9 (https://tezfiles.com/file/601738e5754a9)

Naeite
01-19-2022, 11:42 PM
Clubdom.com- Jamie Valentine: Whipped by his Goddess
https://img202.imagetwist.com/th/45048/v36ovjnowrgl.jpg (https://imagetwist.com/v36ovjnowrgl/cd_s987_jamievalentine_whipping.jpg)
https://img165.imagetwist.com/th/45049/q31dswx9rr2s.jpg (https://imagetwist.com/q31dswx9rr2s/sFrZPPIM.jpg)

Description:
Jamie Valentine decides it is whipping day for her slave. He must endure everything she dishes out. she is determined to turn her white fleshy canvas, bright shades of red. She eats his flesh with a stinging galley whip as he cringes and groans. It_s too bad, there are no breaks here at Clubdom slave. He must continue to suffer More and more strikes she delivers. After a while, the laughing, smiling sadist switches to a black single tail, and she uses it with precision to deliver sharp blows to his back.
Model:
Jamie Valentine
Studio:
Clubdom.com
Info:
File Name : cd_s987_jamievalentine_whipping.mp4
File Size : 314.42 MB
Resolution : 1280x720
Duration : 00:06:42

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/6d1fa3a00abac (https://tezfiles.com/file/6d1fa3a00abac)

Naeite
01-19-2022, 11:44 PM
Clubdom.com- Kylie Rogue Brianna Bye Bye Balls
https://img202.imagetwist.com/th/44822/6blog0hyybjm.jpg (https://imagetwist.com/6blog0hyybjm/s549_kylie_rogue_lydia_supremacy_brianna_bg_bye_ba lls.jpg)
https://img202.imagetwist.com/th/44822/bresm4xt0be5.jpg (https://imagetwist.com/bresm4xt0be5/itmOcxi.jpg)

Description:
GODDESS Brianna, Mistress Kylie Rogue and GODDESS Lydia Supremacy catch their pathetic slave staring at Kylie_s pussy. They bring the bitch out of his cage and inform this slut that he has to earn goddesses pussy. First, he will start by breathing in her asshole taking deep breaths while smelling, licking and worshiping her ass. Then Goddess Brianna tells him they_re going to play a game. The slave has to give Mistress Kylie two orgasms in three minutes and if this bitch fails there will be severe consequences. Failure will result in Brianna injecting a syringe filled with a special chemical into the slaves balls. Once mixed with his semen if he ever ejaculates a again a reaction will occur rendering him impotent for the rest of his pathetic life. His balls will then shrivel up and just fall off never producing another single drop of semen. The women are sadistic and laugh at him while he fucks Mistress Kylie as if his life depended on it. They inform him his time is running out. He better make mistress cum. The slave fucks her as hard and fast as he can. Goddess Lydia asks Kylie if she had 2 orgasms. Kylie says yes he just made it and gets to keep his balls another day. Goddess Brianna catches the slave smirk. The ladies grab him and force him down on the table. Brianna scoops up his pathetic slut sacks while holding up her syringe filled with the serum. She proceeds to slowly inject the green concentrate into his pathetic balls as the women laugh sadistically. The slave cries in pain as he knows that his balls have just been filled and will fall off if he ever ejaculates again. Bye-bye balls
Model:
Goddess Brianna, Kylie Rogue, Lydia Supremacy
Studio:
Clubdom.com
Info:
File Name : s549_kylie_rogue_lydia_supremacy_brianna_bg_bye_ba lls.mp4
File Size : 280.82 MB
Resolution : 1280x720
Duration : 00:05:58

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/8558f39869e16 (https://tezfiles.com/file/8558f39869e16)

Naeite
01-19-2022, 11:53 PM
Clubdom.com- Administers Belly Punches
https://img119.imagetwist.com/th/45085/jprxyqv3rj0m.jpg (https://imagetwist.com/jprxyqv3rj0m/ilejHG.jpg)
https://img202.imagetwist.com/th/45085/g81mqm57inp9.jpg (https://imagetwist.com/g81mqm57inp9/kMgdSZJl.jpg)

Description:
Club Dom features famous Mistresses from around the world engaging in slave training, corporal punishment, ball-busting, CBT, strap-on, and more.
Model:
Teens girls, beautiful girl, milf
Studio:
Clubdom.com
Info:
File Name : Movie501.wmv
File Size : 7.31 MB
Resolution : 320x240
Duration : 00:01:58

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/6d1b4cc9d95e7 (https://tezfiles.com/file/6d1b4cc9d95e7)

Naeite
01-19-2022, 11:54 PM
Clubdom.com- Rikki Rumor Jade Dirty Feet
https://img119.imagetwist.com/th/45043/kfxp6lwhw17w.jpg (https://imagetwist.com/kfxp6lwhw17w/s931rikkirumorjadejantzendirtyfeet.jpg)
https://img119.imagetwist.com/th/45043/n8zrm4ppfm3k.jpg (https://imagetwist.com/n8zrm4ppfm3k/rfHUfPy.jpg)

Description:
Club Dom features famous Mistresses from around the world engaging in slave training, corporal punishment, ball-busting, CBT, strap-on, and more.
Model:
Jade Jantzen, Rikki Rumor
Studio:
Clubdom.com
Info:
File Name : s931rikkirumorjadejantzendirtyfeet.mp4
File Size : 255.68 MB
Resolution : 1280x720
Duration : 00:05:29

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/82c6b5a917cbe (https://tezfiles.com/file/82c6b5a917cbe)

Naeite
01-20-2022, 12:06 AM
Clubdom.com- Jean Bardot Kylie Milking Part 1
https://img69.imagetwist.com/th/44822/v4bxfit9shdm.jpg (https://imagetwist.com/v4bxfit9shdm/s569_jean_bardot_kylie_rogue_part1.jpg)
https://img69.imagetwist.com/th/44822/lxbx6qq2zk2b.jpg (https://imagetwist.com/lxbx6qq2zk2b/uliXiJ.jpg)

Description:
Mistresses Jean Bardot and Kylie Rouge have hired Lew and Alex, two repairmen to do some odd jobs around the property today. Imagine the shock to the two Doms when one of the repairmen turns out to be a canceling male chauvinist pig. Despite the protests of his partner Alex, Lew can_t shut his mouth and stop letting his male arrogance get him deeper and deeper in trouble. Even worse, after being given direct orders from Miss Bardot not to enter her private dungeon, the brazen idiot marches right in at first opportunity, considering her warnings a joke. Little did these two repairmen know that the joke would be on them. We next find our repairmen in the dungeon, Alex in a kennel and loudmouth Lew strapped to a milking bench. Goddess Jean Bardot is furious and decides to remove some of Lews testosterone by milking his overactive balls. Both Mistress Kylie and Goddess Jean take turns roughing pulling and milking Lews pig stick as he both moans on pleasure and cries in agony. The Goddess_s to not let up for a second, taunting and tormenting the loudmouth caveman as they pull his cum out of his cock and then force him to eat it. Not satisfied, Goddess Jean unleashes fury of kicks to the repairman_s_ balls, leaving him howling like a wounded as the Goddess_s move on to repairman Alex. Having been the well behaved one, the Goddesses allow Alex a chance to earn his freedom. If the stud can hold his load and fuck Mistress Kylie and make her cum in under 3 minutes he will be allowed to go free. To drive this point home, Mistress Jean demands Alex deeply inhale the scent of Mistress Kylie womanhood. Driven to please his Masters, Alex fucks the Miss Kylie with all the passion he can muster, finally making her quiver in climax. As Alex withdraws, Goddess Jean realizes that Alex came in his condom as well Furious, the Doms teabag Alex_s slutty mouth with the filled scumbag, then humiliate him by dumping his filth out on his face and in his mouth. Mistress Jean promises he will be punished for an unauthorized orgasm. We return to find both Goddesses amusing themselves punishing Alex by shocking him with a cattle prod. Alex jumps and flails wildly, not knowing where the next jolt of electricity will come from. Both Ladies laugh and laugh at the spectical before them, noticing that the repairman is paying close attention to their boots. Taking mercy on the sad little slut, Mistress Kylie Rouge and Jean Bardot allow the worm to lock and kiss their boots. As the boots become shiny through worship, both Dommes notice that Alex is quite turned on by worshipping their boots, and demand he become a little boot bumper. Alex eagerly humps away like a bunny, slamming his hips and cock into Mistress Kylie boots until he can_t hold back and explodes all over them. Amused, Goddess Jean demands Alex link up his filth. Mistress Kylie mentions how turned on she is, and Goddess Jean remembers that they still have a loudmouth slave to punish. Nothing makes Mistress Kylie cum like the pain and agony of a slave, and Goddess Jean delivers in spades on the rude and arrogant hide of Lew. A brutal caning leaves the loudmouths ass covered in multicolored welts as tears roll down the pigs face and his screams fill the air. all this pain and suffering has Miss Kylie on the verge of orgasm, so Goddess Jean switches to a whip to amp up the pain even more. Spine chilling screams echo throughout the club do estate as Lew begs and pleads for mercy while Miss Kyle reaches orgasm due to his pain. To finally drive home the point that men should respect women both Doms Don their 10 inch strap on cocks and destroy both repairman asses. Both are flipped upside down and InsideOut but neither can escape nor gain any mercy from the monster cocks if Mistress Jean and Kylie. Once completely Fucked, both boys are ordered to clean thier asses off the cocks that just pounded their formally virgin holes. Finally satisfied Goddess Jean tells loudmouth Lew to scram, and he quickly runs for his life off property. However, the cure and respectful Alex is offered a spot in the club do stable.
Model:
Jean Bardot, Kylie Rogue
Studio:
Clubdom.com
Info:
File Name : s569_jean_bardot_kylie_rogue_part1.mp4
File Size : 427.63 MB
Resolution : 1280x720
Duration : 00:08:58

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/28d27e921067d (https://tezfiles.com/file/28d27e921067d)

Naeite
01-20-2022, 12:09 AM
Clubdom.com- Sasha Elena Milking Slut 1027
https://img119.imagetwist.com/th/44824/mjyibwhhj1as.jpg (https://imagetwist.com/mjyibwhhj1as/s603sashameowelenasinhj.jpg)
https://img119.imagetwist.com/th/44824/p96v78ue0blu.jpg (https://imagetwist.com/p96v78ue0blu/pYnVFQ.jpg)

Description:
Time to milk another slut on the ClubDom Estate. Mistress Sasha Meow and Elena Sin pull every last drop of filth from their slaves worthless nut sacks. Stroking his pathetic 2_ dicklett until his balls are ready to explode. They enjoy his cries. He almost had an orgasm as soon as we walked into the room laughs Elena.
Model:
Elena Sin, Sasha Meow
Studio:
Clubdom.com
Info:
File Name : s603sashameowelenasinhj.mp4
File Size : 380.86 MB
Resolution : 1280x720
Duration : 00:08:02

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/0e737de5134dc (https://tezfiles.com/file/0e737de5134dc)

Naeite
01-20-2022, 12:11 AM
Clubdom.com- Fuck Your Goddess
https://img119.imagetwist.com/th/45073/k2bjsaryuaj9.jpg (https://imagetwist.com/k2bjsaryuaj9/cd_s1228_brianna_parisknight_fucking.jpg)
https://img202.imagetwist.com/th/45073/lkhmcst8jwvw.jpg (https://imagetwist.com/lkhmcst8jwvw/KltpGmI.jpg)

Description:
Goddess Brianna and Paris Knight are teaching Paris_s husband how to be more in tune to her needs and pay more attention to pleasing her. This harsh lesson comes in the form of going to Club Dom to meet Goddess Brianna and get him to go through a series of lessons. Brianna threatens him with a cattle prod and makes him fuck Paris the way Paris needs to be fucked. He isn_t allowed to cum, only she is and that is the way it should always be.
Model:
Goddess Brianna, Paris Knight
Studio:
Clubdom.com
Info:
File Name : cd_s1228_brianna_parisknight_fucking.mp4
File Size : 332.87 MB
Resolution : 1280x720
Duration : 00:07:03

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/d4efdcf2a3a47 (https://tezfiles.com/file/d4efdcf2a3a47)

Naeite
01-20-2022, 12:11 AM
Clubdom.com- A Ball Between Friends
https://img119.imagetwist.com/th/45173/22dmid80ua8e.jpg (https://imagetwist.com/22dmid80ua8e/movie766cfs.jpg)
https://img119.imagetwist.com/th/45173/iarc91t251r1.jpg (https://imagetwist.com/iarc91t251r1/SHwvaBYS.jpg)

Description:
Cheyenne and Katherine are ready for a work out. They have picked out a helpless little ball bitch to be their punching bag. Cheyenne and Katherine have a great time kicking and punching the bitch. Katherine holds the bitch as Cheyenne delivers cruel blows to his balls. Then Katherine grabs the bitch_s balls up and punches them with full force. The ladies laugh as the slut falls to the ground, unable to catch his breath. Oh, we aren_t done yet Katherine laughs as she begins stomping the slut_s aching balls. Cheyenne drags the bitch back to his feet. The ladies commence with brutal blows to the balls until the slut is down for good. As he lays on the ground unable to move, Cheyenne gives him once last kick. Cheyenne and Katerine are radiant in this video. They are simply having a ball
Model:
Teens girls, beautiful girl, milf
Studio:
Clubdom.com
Info:
File Name : movie766cfs.mp4
File Size : 58.34 MB
Resolution : 640x480
Duration : 00:05:00

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/933d03c116046 (https://tezfiles.com/file/933d03c116046)

Naeite
01-20-2022, 12:13 AM
Clubdom.com- Mistress Maria Needs Her Orgasm
https://img202.imagetwist.com/th/45073/yponu8fpybj9.jpg (https://imagetwist.com/yponu8fpybj9/cd_s1223_4-6_mariamarley_chindo.jpg)
https://img119.imagetwist.com/th/45073/klaujlrsmlc4.jpg (https://imagetwist.com/klaujlrsmlc4/dIpaCJj.jpg)

Description:
Mistress Maria Marley is teaching her slaves what serving her is all about. That includes, their suffering and her pleasure Maria knows just what she wants today a nice deep dicking. She doesn_t want it from a real cock, as that would be too high of a reward for these pathetic slaves. Instead, she wants the slave to strap-on a dildo gag and fuck her good and deep, making her cum, OR ELSE
Model:
Maria Marley
Studio:
Clubdom.com
Info:
File Name : cd_s1223_4-6_mariamarley_chindo.mp4
File Size : 386.6 MB
Resolution : 1280x720
Duration : 00:08:09

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/a99fb10d6219f (https://tezfiles.com/file/a99fb10d6219f)

Naeite
01-20-2022, 12:13 AM
Clubdom.com- Club Hookup Gone Bad (Jerking Off)
https://img33.imagetwist.com/th/44660/wzi0bjoxqs06.jpg (https://imagetwist.com/wzi0bjoxqs06/sh_03_03_13_minimoviepart3.jpg)
https://img33.imagetwist.com/th/44660/1biatwg9f4yl.jpg (https://imagetwist.com/1biatwg9f4yl/sh_03_03_13_minimoviepart3.mp4.jpg)

Description:
Goddesses Tristan and Amadahy have returned from a night of partying at the club and are in the mood to humiliate their caged slave. They order him out of his cage and tell him they are going to fill his mouth and ass full of strapon cock - and the only lube they are going to use is his own cum

Amadahy orders the bitch to jerk himself off, laughing the entire time as he jerks on his tiny dick hoping to actually be able to produce some cum. The slave succeeds in producing a load, just enough to get Amadahy_s glove dirty. At least he will not be getting totally dry fucked.
Model:
Goddess Amadahy
Studio:
Clubdom.com
Info:
File Name : sh_03_03_13_minimoviepart3.mp4
File Size : 243.17 MB
Resolution : 1280x720
Duration : 00:05:09

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/fd737290ffcbc (https://tezfiles.com/file/fd737290ffcbc)

Naeite
01-20-2022, 12:16 AM
Clubdom.com- Mistress Kendra James And Goddess Amadahy Instruct and Humiliate
https://img33.imagetwist.com/th/44667/2gg9vo4rprip.jpg (https://imagetwist.com/2gg9vo4rprip/povkenama.jpg)
https://img119.imagetwist.com/th/44667/hy0fmweua7ad.jpg (https://imagetwist.com/hy0fmweua7ad/povkenama.mp4.jpg)

Description:
Mistress Kendra James and Goddess Amadahy are standing by there caged slave when they see you sitting there with your tiny erect cock. The mistress cant believe what a disgusting piece of you are. The mistresses let you know you are only to get erect by them and they are going to make you stroke it to them. The mistress are going to make you stroke your cock in front of them as they verbally humiliate you. The mistress make you stop and restart to you insane. The mistress think this is getting to pleasant for you. The mistress tell you to fuck you ass with your finger and you stroke your cock to there instructions. The mistress let you know the hell you will pay if you cum to soon. The mistress want you to beg and be before you spill your pathetic load.
Model:
Goddess Amadahy, Kendra James
Studio:
Clubdom.com
Info:
File Name : povkenama.mp4
File Size : 55.77 MB
Resolution : 640x360
Duration : 00:05:51

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/ae4b2ca73ea31 (https://tezfiles.com/file/ae4b2ca73ea31)

Naeite
01-20-2022, 12:17 AM
Clubdom.com- Your Cock is too Small for Kitty and Valora (POV)
https://img119.imagetwist.com/th/45183/t6l4dwg6iszc.jpg (https://imagetwist.com/t6l4dwg6iszc/cd_s1361_valora_kitty_smallpenispov.jpg)
https://img202.imagetwist.com/th/45183/yrcjk51h5bol.jpg (https://imagetwist.com/yrcjk51h5bol/TWhJVcc.jpg)

Description:
Kitty Carrera and Goddess Valora are beautiful, smart, dominant women with hot smoking bodies. Did you think that you could ever be with them? Did you think you could be their boyfriend? Did you think you could fuck them? Did you think that your tiny cock could ever please them? Well, youre an idiot And so, wrong Watch Kitty and Valora humiliate and laugh at you and your pathetic cock. They will make you feel like the loser that you are
Model:
Goddess Valora, Kitty Carrera
Studio:
Clubdom.com
Info:
File Name : cd_s1361_valora_kitty_smallpenispov.mp4
File Size : 240.62 MB
Resolution : 1280x720
Duration : 00:05:06

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/94c96ad699c99 (https://tezfiles.com/file/94c96ad699c99)

Naeite
01-20-2022, 12:19 AM
Clubdom.com- Mistress Picks a Cock
https://img119.imagetwist.com/th/45172/sunme9ya39di.jpg (https://imagetwist.com/sunme9ya39di/movie327cfs.jpg)
https://img202.imagetwist.com/th/45172/i37kghdnu5lp.jpg (https://imagetwist.com/i37kghdnu5lp/sKdTzCs.jpg)

Description:
Mistress Dante Posh arrives at Cheyenne_s studio to find a note on the door: Please choose a slave to entertain you. The other, feel free to discard. Mistress Dante discovers two slave_s locked in cages in the dungeon. Their cock and balls are locked in humblers through the cages. The slaves are utterly helpless as Dante evaluates their cocks. Who will sleep at her feet and who will sleep on the floor of their cold cage? Only Mistress Dante_s single tail whip will decide. She whips and smacks their cock and balls to decide which cock is to her liking.
Model:
Dante Posh
Studio:
Clubdom.com
Info:
File Name : movie327cfs.mp4
File Size : 68.23 MB
Resolution : 640x480
Duration : 00:05:50

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/cf7266ce29555 (https://tezfiles.com/file/cf7266ce29555)

Naeite
01-20-2022, 12:20 AM
Clubdom.com- A Good Boot Bitch
https://img119.imagetwist.com/th/45075/53ii1qq38yir.jpg (https://imagetwist.com/53ii1qq38yir/cd_s1179_cleo_bootworship.jpg)
https://img202.imagetwist.com/th/45075/26ks0quku094.jpg (https://imagetwist.com/26ks0quku094/ppWnDoNI.jpg)

Description:
Goddess Cleo knows what her boot slut wants, and opens his cage to tease him with the boots. She sits on his cage and commands him to lick the dirty bottoms of her boots. Cleo_s boot slut sucks like a good little boot whore. He uses his tongue to clean her boots at his Goddess_s will. Goddess Cleo wants him to suck her heel like he sucks cock, and uses her heel too. Cleo commands her slave to stroke his cock and spill his filth over her boots. After he creates a mess on her boots, Goddess Cleo makes him eat his own cum to make her boots clean again.
Model:
Cleo
Studio:
Clubdom.com
Info:
File Name : cd_s1179_cleo_bootworship.mp4
File Size : 307.33 MB
Resolution : 1280x720
Duration : 00:06:31

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/2f125e66c7e2b (https://tezfiles.com/file/2f125e66c7e2b)

Naeite
01-20-2022, 12:21 AM
Clubdom.com- Borrowing A Slave_s Ass
https://img202.imagetwist.com/th/45059/n664taczzu0w.jpg (https://imagetwist.com/n664taczzu0w/cd_s1132_mistresslydia_mistresscheyenne_strapon.jp g)
https://img119.imagetwist.com/th/45059/zdmejren47ev.jpg (https://imagetwist.com/zdmejren47ev/YaxgdARb.jpg)

Description:
Mistress Lydia Supremacy and Mistress Cheyenne borrow a slave from their friend to train his pathetic ass how to take a cock. Mistress Cheyenne shoves her strap on cock in his throat so the slave can drool and choke all over it. Soon, Mistress Lydia and Mistress Cheyenne have the slave bent over where Mistress Cheyenne spreads his man pussy open so Mistress Lydia can shove her long hand held cock deep in his gaping unused hole. After Mistress Lydia loosens him up, Mistress Cheyenne gives him the rough ride she promised him, pegging his tight virgin man pussy. Mistress Cheyenne then starts pile drive pegging his ass, making sure he_s ready to be able to take any dick his Mistress can stuff in him, and leaving him craving for more cock.
Model:
Goddess Cheyenne, Lydia Supremacy, Michelle Lacy
Studio:
Clubdom.com
Info:
File Name : cd_s1132_mistresslydia_mistresscheyenne_strapon.mp 4
File Size : 286.99 MB
Resolution : 1280x720
Duration : 00:06:05

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/71fa4ee3a1055 (https://tezfiles.com/file/71fa4ee3a1055)

Naeite
01-20-2022, 12:23 AM
Clubdom.com- School Girls Make You Cum
https://img119.imagetwist.com/th/45071/xyfkxwwvw4nk.jpg (https://imagetwist.com/xyfkxwwvw4nk/cd_s1210_evelinstone_kenziereeves_joi_pov.jpg)
https://img202.imagetwist.com/th/45071/plibngfkk6jl.jpg (https://imagetwist.com/plibngfkk6jl/jfECrEbM.jpg)

Description:
These two gorgeous school girls demand that you stroke your tiny cock for them. Evelin Stone and Kenzie Reeves want to see how hard you get watching them walk to and from their classes. Now is your chance to stroke it on your knees and eat up all of your cum just like these two bossy school girls tell you to. You are weak for them.
Model:
Evelin Stone, Kenzie Reeves
Studio:
Clubdom.com
Info:
File Name : cd_s1210_evelinstone_kenziereeves_joi_pov.mp4
File Size : 245.36 MB
Resolution : 1280x720
Duration : 00:05:09

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/98318cc50c25e (https://tezfiles.com/file/98318cc50c25e)

Naeite
01-20-2022, 12:25 AM
Clubdom.com- Wet Pussy Caning
https://img33.imagetwist.com/th/44664/4q88dc2y7w3g.jpg (https://imagetwist.com/4q88dc2y7w3g/cd_04_13_13_caningcd.jpg)
https://img119.imagetwist.com/th/44664/ms16ni7usbnt.jpg (https://imagetwist.com/ms16ni7usbnt/cd_04_13_13_caningcd.mp4.jpg)

Description:
Mistress Trinity is a severe sadist who loves making her slaves beg for the pain she is about to deliver and gets off from inflicting pain. Trinity orders her slave to beg her for the cane, then proceeds to blister his ass red with stroke after stroke. Trinity is merciless, mocking the slave for pleading for mercy after begging to be caned.

Trinity inspects the slave_s red ass, then feels her pussy, wet from seeing the damage he has caused. She makes the slave taste her pussy juices off of her gloved fingers, telling him that this is the closest he will ever get to her pussy.
Model:
Trinity St. Clair
Studio:
Clubdom.com
Info:
File Name : cd_04_13_13_caningcd.mp4
File Size : 58.64 MB
Resolution : 640x360
Duration : 00:06:06

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/412240cc3e50d (https://tezfiles.com/file/412240cc3e50d)

Naeite
01-20-2022, 12:41 AM
Clubdom.com- Goddess Valora and Kitty Carrera Slut Training (POV)
https://img202.imagetwist.com/th/45183/souv08hkc974.jpg (https://imagetwist.com/souv08hkc974/cd_s1360_valora_kitty_sissypov.jpg)
https://img202.imagetwist.com/th/45184/cgs2cl92fwj5.jpg (https://imagetwist.com/cgs2cl92fwj5/jSLTxLy.jpg)

Description:
Goddess Valora and Mistress Kitty are out by the pool and they have some things to teach you today You better not be playing with your little cock unless they say so. First of all, why are your hands even free? Put your hands under your ass and sit on them. Listen to these Goddesses tell you how to touch yourself properly. They know that deep down youre just a sissy slut. In fact, you are lucky to even have their attention in the first place. So, take notes and learn how a sissy should please their Goddess. How to suck their cocks. How to be used by their cocks in every hole.
Model:
Goddess Valora, Kitty Carrera
Studio:
Clubdom.com
Info:
File Name : cd_s1360_valora_kitty_sissypov.mp4
File Size : 205.32 MB
Resolution : 1280x720
Duration : 00:04:20

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/3469f3beeeec8 (https://tezfiles.com/file/3469f3beeeec8)

Naeite
01-20-2022, 12:43 AM
Clubdom.com- Lydia Supremacy Kylie Rogue Caning
https://img69.imagetwist.com/th/44834/57s4cohvdt3b.jpg (https://imagetwist.com/57s4cohvdt3b/s842lydiasupremacykylieroguecaning.jpg)
https://img119.imagetwist.com/th/44834/pn2gkk5r2n2q.jpg (https://imagetwist.com/pn2gkk5r2n2q/VlmNoYYR.jpg)

Description:
A proper slave would have cleaned the carpet correctly the first time he was ordered. Mistress Lydia Supremacy is not impressed with this maggot_s cleaning work, however. She orders him to bring it outside and after inviting Kylie Rogue to Join her, binds his hands as he kneels over the carpet. Their canes are going to be worn out today Lydia wastes no time delivering severe blows on the slave_s ass while he is told to analyze the carpet_s filthy state while he gets disciplined. having nothing to keep him up during the cruel caning, the slave falls over repeatedly from the excruciating slams on his welted ass, which amuses his Mistresses into doing their worst. The punishing strokes leave his ass marked red and swollen, Lydia examines the marks and the slave_s trembling legs, deciding she isn_t satisfied and will hold him in place while Kylie continues his lesson...Mercilessly
Model:
Kylie Rogue, Lydia Supremacy
Studio:
Clubdom.com
Info:
File Name : s842lydiasupremacykylieroguecaning.mp4
File Size : 252.05 MB
Resolution : 1280x720
Duration : 00:05:21

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/51d4674024f98 (https://tezfiles.com/file/51d4674024f98)

Naeite
01-20-2022, 12:48 AM
Clubdom.com- Jamie Valentine Kimber StrapOn Fucking
https://img165.imagetwist.com/th/44830/2lgbag1czvlx.jpg (https://imagetwist.com/2lgbag1czvlx/s732jamievalentinekimberwoodsstrapon.jpg)
https://img165.imagetwist.com/th/44830/36qp09w8ybqm.jpg (https://imagetwist.com/36qp09w8ybqm/FoBpRRcL.jpg)

Description:
Club Dom features famous Mistresses from around the world engaging in slave training, corporal punishment, ball-busting, CBT, strap-on, and more.
Model:
Jamie Valentine, Kimber Woods
Studio:
Clubdom.com
Info:
File Name : s732jamievalentinekimberwoodsstrapon.mp4
File Size : 338.22 MB
Resolution : 1280x720
Duration : 00:07:08

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/df9589c6c4b67 (https://tezfiles.com/file/df9589c6c4b67)

Naeite
01-20-2022, 12:52 AM
Clubdom.com- Natalia, Paris, Michelle: Two Whips for Two slaves
https://img202.imagetwist.com/th/45042/mujevchzorav.jpg (https://imagetwist.com/mujevchzorav/s913nataliaparismichellelacywhipping.jpg)
https://img202.imagetwist.com/th/45042/aivtou5pqvub.jpg (https://imagetwist.com/aivtou5pqvub/vUlFHn.jpg)

Description:
Before selling her slave to Mistresses Natalia and Paris, Mistress Michelle Lacy gives him a goodbye whipping. As Michelle whips her sold slave and another unfortunate stable slave with two very merciless whips, she reminds her bitch that his new purpose in life will be to serve his new owners and make them happy. But she wants to give him some pain to remember her by first.
Model:
Michelle Lacy, Natalia Starr, Paris Knight
Studio:
Clubdom.com
Info:
File Name : s913nataliaparismichellelacywhipping.mp4
File Size : 218.05 MB
Resolution : 1280x720
Duration : 00:04:37

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/e4e26661f1ed8 (https://tezfiles.com/file/e4e26661f1ed8)

Naeite
01-20-2022, 01:01 AM
Clubdom.com- Jamie Valentine Olivia: Submit or SUFFER
https://img202.imagetwist.com/th/45050/las9wnxttl5b.jpg (https://imagetwist.com/las9wnxttl5b/cd_s1011_4-5_jamievalentine_oliviafox_chindoballshock.jpg)
https://img202.imagetwist.com/th/45050/s54gj58ek5x8.jpg (https://imagetwist.com/s54gj58ek5x8/vXTleer.jpg)

Description:
Guardesses Jamie Valentine and Olivia Fox have their slave on his knees, with a dildo gag on his face. The women laugh at how small his penis is in comparison to the dildo he wears on his head. He could never pleasure a woman with that tiny thing The women try to make him get an erection by showing him their large breasts, seeing if perhaps anything will grow. it doesn_t. He has to fuck Olivia with the dildo gag, and he has 3 minutes to make her cum. If not, Jamie and Olivia are going to fry his balls with a cattle prod.
Model:
Jamie Valentine, Olivia Fox
Studio:
Clubdom.com
Info:
File Name : cd_s1011_4-5_jamievalentine_oliviafox_chindoballshock.mp4
File Size : 282.95 MB
Resolution : 1280x720
Duration : 00:05:58

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/a523dea273fed (https://tezfiles.com/file/a523dea273fed)

Naeite
01-20-2022, 01:02 AM
Clubdom.com- Brutal Double Ass Fucking
https://img202.imagetwist.com/th/45069/k9oy7guuyme9.jpg (https://imagetwist.com/k9oy7guuyme9/cd_s681_full_rilynnrae_roxiiblair.jpg)
https://img202.imagetwist.com/th/45069/xv42gnqodp42.jpg (https://imagetwist.com/xv42gnqodp42/cPIqQs.jpg)

Description:
These Goddess_s know all you dream of is big black cock stretching out your pathetic man cunt you fantasize about Goddess Rilynn Rae and Mistress Roxii Blair pounding your little pussy owning you completely, dominating, you and then allowing you to stroke that little 2 inch slut stick only to lick up your own filth and get back in your cage.Mistress Roxii Blair and Goddess Rilynn Rae love fucking and stretching out man pussy both Goddess_s are strapped up with 12 Hard black cock and ready to fuck some slutty slave ass, they lead their bitches in on a double leash as Goddess Rilynn whips them and makes them beg for cock, they flip these slaves into Pyle driver to get even deeper penetration and achieve maximum stretching of these slaves asses The Ladies fuck them silly laughing and loving every minute of it.
Model:
Rilynn Rae, Roxii Blair
Studio:
Clubdom.com
Info:
File Name : cd_s681_full_rilynnrae_roxiiblair.mp4
File Size : 689.49 MB
Resolution : 1280x720
Duration : 00:14:34

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/eaf1d23096c71 (https://tezfiles.com/file/eaf1d23096c71)

Naeite
01-20-2022, 01:09 AM
Clubdom.com- Marathon Ball Busting
https://img202.imagetwist.com/th/45172/mpmraecrwmzc.jpg (https://imagetwist.com/mpmraecrwmzc/movie315cfs.jpg)
https://img202.imagetwist.com/th/45172/u9skbngk6nt9.jpg (https://imagetwist.com/u9skbngk6nt9/iALzAVx.jpg)

Description:
Cheyenne has her boy pad locked to the floor with his legs in a steel device. There is no escaping her harsh kicks. After she pummels his balls she decides to stand him up and take a running kick. The slave is still breathing so Cheyenne puts him beside her trampoline. She ties up his cock and demands he hold it out of the way as she gets clear brute force kicks to his balls. The ball bitch is utterly helpless as Cheyenne devours his balls with her beautiful but lethal bare feet.
Model:
Teens girls, beautiful girl, milf
Studio:
Clubdom.com
Info:
File Name : movie315cfs.mp4
File Size : 51.77 MB
Resolution : 640x480
Duration : 00:04:20

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/65d7d06df8aff (https://tezfiles.com/file/65d7d06df8aff)

Naeite
01-20-2022, 01:14 AM
Clubdom.com- Caned For Them
https://img202.imagetwist.com/th/45075/ojpi4yk5jhnu.jpg (https://imagetwist.com/ojpi4yk5jhnu/OwpwNf.jpg)
https://img119.imagetwist.com/th/45075/qij1oo92ppdg.jpg (https://imagetwist.com/qij1oo92ppdg/sARAFT.jpg)

Description:
Mistress Kendra and Mistress Haley want to give their slave extreme pain and there is nothing that does that job more quickly than a fierce caning. He will be wearing stripes across his pathetic ass all week long in front of everyone else at the estate while he walks around, showing the other slaves what happens when they step out of line. Kendra and Hadley enjoy taking turns caning his pathetic ass. His cries only make them want to do it harder
Model:
Hadley Viscara, Kendra James
Studio:
Clubdom.com
Info:
File Name : CD_S1252_KendraJames_HadleyVascara_Caning.mp4
File Size : 1173.28 MB
Resolution : 1920x1080
Duration : 00:08:07

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/7dfa120061170 (https://tezfiles.com/file/7dfa120061170)

Naeite
01-20-2022, 01:15 AM
Clubdom.com- Kendra Alexa Strapon Chindo
https://img119.imagetwist.com/th/44822/68eonlotg0ej.jpg (https://imagetwist.com/68eonlotg0ej/s547_kendra_alexa_rydell_strap_on_chido.jpg)
https://img202.imagetwist.com/th/44822/rbliwts3kc6n.jpg (https://imagetwist.com/rbliwts3kc6n/AQwVSU.jpg)

Description:
GODDESS Kendra and Alexa strap the ball shocker to the slaves pathetic slut sacks. Then place a chindo on his face and instruct him to pleasure Alexa while Mistress Kendra fucks his man pussy he must pleasure her over and over again giving her multiple orgasms as his pathetic ball sacks are shocked and his fuck hole rammed by Mistress Kendra_s 10 inch black cock.
Model:
Alexa Rydell, Kendra James
Studio:
Clubdom.com
Info:
File Name : s547_kendra_alexa_rydell_strap_on_chido.mp4
File Size : 315.04 MB
Resolution : 1280x720
Duration : 00:06:39

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/0db404cb784e2 (https://tezfiles.com/file/0db404cb784e2)

Naeite
01-20-2022, 01:17 AM
Clubdom.com- One Last Ride
https://img202.imagetwist.com/th/45172/aa137njwunoc.jpg (https://imagetwist.com/aa137njwunoc/movierv325.jpg)
https://img202.imagetwist.com/th/45172/5kslk9sukl1r.jpg (https://imagetwist.com/5kslk9sukl1r/szKSmlb.jpg)

Description:
Lady Cheyenne wheels her pig in on a cart. She circles him, pinching at his flesh. Cheyenne informs him that he_ll be a special guest at her dinner party. She and girlfriends will be roasting him. She imagines that he_ll be a wonderful dish, having been fattened up just enough. Then she puts on her favorite 10 inch cock. You were my favorite fuck for a long time Cheyenne tells her bitch. Your ass is so tight. I want one last ride. Cheyenne fucks her pig long and hard. Then she gets out a dildo night stick and drives it all the way in the bitch_s hole, making him keep his ass tight. This is hot strap on action.
Model:
Teens girls, beautiful girl, milf
Studio:
Clubdom.com
Info:
File Name : movierv325.mp4
File Size : 74.66 MB
Resolution : 640x480
Duration : 00:06:21

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/038e9d2dbc59d (https://tezfiles.com/file/038e9d2dbc59d)

Naeite
01-20-2022, 01:21 AM
Clubdom.com- Edged and Fed in The 7 Gates of Hell
https://img33.imagetwist.com/th/44823/hhbvtrldxbx7.jpg (https://imagetwist.com/hhbvtrldxbx7/s596davafoxxesmileemollyjane7gatesofhellhj.jpg)
https://img202.imagetwist.com/th/44823/v5eax34slehf.jpg (https://imagetwist.com/v5eax34slehf/nqnhbn.jpg)

Description:
Mistress Esmi Lee, Goddess Dava Foxx and Mistress Molly Jane like playing games with their slaves. They have this bitch locked up in the seven gates of hell restricting has pathetic slut stick as they tease him with a vibrator. Slowly stroking his cock with their black gloved hands bringing him right to the brink and slowly spitting on his cock, stroking it fast and then slow. Just playing games with this bitch working his slut stick right to the edge where his balls are about to explode and then stopping and just laughing at him as he begs for release. Masturbation games can be fun don_t you think slave? Finally they make the bitch beg to be fed his own cum please feed me my man filth Goddess. The slave then explodes a thick white load of disgusting filth into Goddess Esmi_s hand. The ladies fishhook the _ mouth wide-open and wipe every last disgusting drop of goo into the bitches mouth.
Model:
Dava Foxx, Esmi Lee, Molly Jane
Studio:
Clubdom.com
Info:
File Name : s596davafoxxesmileemollyjane7gatesofhellhj.mp4
File Size : 396.43 MB
Resolution : 1280x720
Duration : 00:08:16

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/5cd9b0d92559b (https://tezfiles.com/file/5cd9b0d92559b)

Naeite
01-20-2022, 01:34 AM
Clubdom.com- Sadistic Painful Whippings
https://img33.imagetwist.com/th/44667/vwphd49ebtu2.jpg (https://imagetwist.com/vwphd49ebtu2/sadisticpainfulwhippings.jpg)
https://img202.imagetwist.com/th/44667/6tn5ztwmngx6.jpg (https://imagetwist.com/6tn5ztwmngx6/sadisticpainfulwhippings.mp4.jpg)

Description:
Mistress Kendra James and Goddess Amadahy have there whips out and are ready to use them. The mistresses have there slave bound and naked. The slave is completely helpless and at the Mistress mercy. Unfortunately for the slave the mistresses show him no mercy. The Mistress brutally attack the slave with a frenzy of whippings. Goddess Amadahy starts the whipping assault then Mistress Kendra joins in. The Mistress non stop slash his back with there fearsome blows till he is broken. The Mistress laugh as the slave screams an agony. The slave cannot take it any more but Mistress will not stop. The mistress whip him till he is nothing more then tenderized meat.
Model:
Goddess Amadahy, Kendra James
Studio:
Clubdom.com
Info:
File Name : sadisticpainfulwhippings.mp4
File Size : 81.63 MB
Resolution : 640x360
Duration : 00:08:34

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/21570582c70b4 (https://tezfiles.com/file/21570582c70b4)

Naeite
01-20-2022, 01:36 AM
Clubdom.com- Belly Busting
https://img119.imagetwist.com/th/45168/6p7y3qnb3wf8.jpg (https://imagetwist.com/6p7y3qnb3wf8/movie711cfs.jpg)
https://img202.imagetwist.com/th/45168/73coy2prae1k.jpg (https://imagetwist.com/73coy2prae1k/IEgazSG.jpg)

Description:
Cheyenne canes, punches and twists her slut_s belly. As her boy twists and moans, Cheyenne holds him in place by his nipple and lays in with repeated deep cane strokes.
Model:
Teens girls, beautiful girl, milf
Studio:
Clubdom.com
Info:
File Name : movie711cfs.mp4
File Size : 28.29 MB
Resolution : 640x480
Duration : 00:02:22

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/1ea4029045458 (https://tezfiles.com/file/1ea4029045458)

Naeite
01-20-2022, 02:03 AM
Clubdom.com- Tug Of Balls
https://img202.imagetwist.com/th/44717/nak3jcrzeogb.jpg (https://imagetwist.com/nak3jcrzeogb/tugoballs.jpg)
https://img202.imagetwist.com/th/44717/2jdhi2ctsrpa.jpg (https://imagetwist.com/2jdhi2ctsrpa/tugoballs.mp4.jpg)

Description:
Kendra,Elana, and Kimmy have two slaves across from each other with a rope tied to each others balls. Kendra has devised a game to amuse her and the other Mistress_s. The game is tug off balls. Whoever wins is allowed to cum. The slaves have no choice if they want to participate in the game or not. The slaves are in excruciating pain as they tug on each others balls. Finally one slave wins and is allowed to cum. The Mistress_s force the winner to jerk off in front of them and clean up his man filth of the floor with his tongue.
Model:
Elena Sin, Kendra James, Kimmylee
Studio:
Clubdom.com
Info:
File Name : tugoballs.mp4
File Size : 237.99 MB
Resolution : 640x360
Duration : 00:07:44

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/2e4625f6c41e9 (https://tezfiles.com/file/2e4625f6c41e9)

Naeite
01-20-2022, 02:04 AM
Clubdom.com- Make him feel it
https://img119.imagetwist.com/th/45080/ylaiv9y9t6qp.jpg (https://imagetwist.com/ylaiv9y9t6qp/zWAekUt.jpg)
https://img119.imagetwist.com/th/45080/bizph65s5u50.jpg (https://imagetwist.com/bizph65s5u50/WfFlQfD.jpg)

Description:
Nadia White and Goddess Valora want to see the slave suffer. They have their whimpering bitch under their complete control and he must take his punishment. The two women cane him mercilessly. He should suffer for their amusement, it_s only right that he as a man should be a slave to these gorgeous Mistresses. The slave receives dozens of stripes before the women tire out.
Model:
Goddess Valora, Nadia White
Studio:
Clubdom.com
Info:
File Name : CD_S1250_2-2_Tangent_SunnyChase_Strapon.mp4
File Size : 388.63 MB
Resolution : 1920x1080
Duration : 00:06:40

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/24b4833ae62b1 (https://tezfiles.com/file/24b4833ae62b1)

Naeite
01-20-2022, 02:14 AM
Clubdom.com- Lexi Luna Teases and Torments
https://img202.imagetwist.com/th/45167/y4hroe2q1w8k.jpg (https://imagetwist.com/y4hroe2q1w8k/cd_s1311_lexiluna_pussytease.jpg)
https://img202.imagetwist.com/th/45167/5kj4fhgnnsjo.jpg (https://imagetwist.com/5kj4fhgnnsjo/lqTSgPAh.jpg)

Description:
Lexi Luna wearing a sexy fire engine red latex dress, with patent spike pumps calls her hooded slave over. Lexi has what men want, and knows how to use it to get them to succumb to her ways. She pulls the slave over, and pulls up her dress and shows him her pussy. She knows how bad, how desperately he wants just a taste. She torments him by pulling his face to her pussy, letting him glance at it, smell it, and hope that he could taste it. She plays with herself, but even more with him. Tormenting him, placing her fingers by his mouth and nose, telling him how her pussy controls him. Threatening him with her cane, will he prove himself worthy of her and her glorious pussy.
Model:
Lexi Luna
Studio:
Clubdom.com
Info:
File Name : cd_s1311_lexiluna_pussytease.mp4
File Size : 302.79 MB
Resolution : 1280x720
Duration : 00:06:24

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/d65515ff988f5 (https://tezfiles.com/file/d65515ff988f5)

Naeite
01-20-2022, 02:23 AM
Clubdom.com- Cum For Goddess
https://img202.imagetwist.com/th/45065/b30tt8u04map.jpg (https://imagetwist.com/b30tt8u04map/cd_s1127_michellelacy_pov.jpg)
https://img119.imagetwist.com/th/45065/y286bygagviu.jpg (https://imagetwist.com/y286bygagviu/MvvRhuVg.jpg)

Description:
Goddess Michelle Lacy is standing before you in her latex dress laughing at your pathetic little dick. Are you afraid to touch it in front of her because you know how pathetic it is? Goddess Michelle commands you to stroke your disgusting clit stick and listen to her commands.
Model:
Michelle Lacy
Studio:
Clubdom.com
Info:
File Name : cd_s1127_michellelacy_pov.mp4
File Size : 231.46 MB
Resolution : 1280x720
Duration : 00:04:55

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/881fac33c6642 (https://tezfiles.com/file/881fac33c6642)

Naeite
01-20-2022, 02:24 AM
Clubdom.com- Isobel Devi Veronica Snow POV
https://img119.imagetwist.com/th/45051/id49jxfztd1s.jpg (https://imagetwist.com/id49jxfztd1s/cd_s1034_isobeldevi_veronicasnow_pov.jpg)
https://img119.imagetwist.com/th/45051/pikj8qea1cwj.jpg (https://imagetwist.com/pikj8qea1cwj/VghjYej.jpg)

Description:
What do you have underneath that man-costume that you call clothing, to please Princess Isobel? Anything good in those pants? HA You could never please Bulgarian Princess Isobel with that thing you call a dick between your legs Can you make it grow? Stroke it for her. Do as she says. Make her happy by giving up all control to your Princess.
Model:
Isobel Devi, Veronica Snow
Studio:
Clubdom.com
Info:
File Name : cd_s1034_isobeldevi_veronicasnow_pov.mp4
File Size : 344.74 MB
Resolution : 1280x720
Duration : 00:07:18

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/049bc72be8175 (https://tezfiles.com/file/049bc72be8175)

Naeite
01-20-2022, 02:26 AM
Clubdom.com- Femdom Sex by Two Mistresses
https://img202.imagetwist.com/th/44741/g3rkt1cbe5nl.jpg (https://imagetwist.com/g3rkt1cbe5nl/s448_human_dildo.jpg)
https://img33.imagetwist.com/th/44741/dyy87kbjzyip.jpg (https://imagetwist.com/dyy87kbjzyip/s448_human_dildo.mp4.jpg)

Description:
Club Dom features famous Mistresses from around the world engaging in slave training, corporal punishment, ball-busting, CBT, strap-on, and more.
Model:
Raven Bay
Studio:
Clubdom.com
Info:
File Name : s448_human_dildo.mp4
File Size : 315.15 MB
Resolution : 1280x720
Duration : 00:06:43

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/461d5dcd341bf (https://tezfiles.com/file/461d5dcd341bf)

Naeite
01-20-2022, 02:32 AM
Clubdom.com- His Pain is Her Pleasure
https://img202.imagetwist.com/th/44722/x2905v321ido.jpg (https://imagetwist.com/x2905v321ido/cd_s418_face_smacking_whipping.jpg)
https://img119.imagetwist.com/th/44722/3c3put3clc3d.jpg (https://imagetwist.com/3c3put3clc3d/cd_s418_face_smacking_whipping.mp4.jpg)

Description:
Goddess and Mistress Kimylee are sadistic women. They drag a stable slave out of his cage and begin smacking him in the face. Kimylee puts him in a head lock as Brianna wails on his face, turning it bright red. Then they suspend the bitch by his wrists and whip the bitch_s back with a single tail. The ladies delight in tormenting this male bitch.
Model:
Goddess Brianna
Studio:
Clubdom.com
Info:
File Name : cd_s418_face_smacking_whipping.mp4
File Size : 261.99 MB
Resolution : 1280x720
Duration : 00:05:29

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/f3a96d030e09b (https://tezfiles.com/file/f3a96d030e09b)

Naeite
01-20-2022, 02:36 AM
Clubdom.com- Dava Foxx Kylie: Milking Your Slut Stick
https://img119.imagetwist.com/th/44826/u6v8c8zfxmw8.jpg (https://imagetwist.com/u6v8c8zfxmw8/s669davakyliemilking.jpg)
https://img119.imagetwist.com/th/44827/g547xbsc801c.jpg (https://imagetwist.com/g547xbsc801c/IviaRN.jpg)

Description:
Goddess Kylie Rogue and Mistress Dava Foxx milk another slave_s slut stick its been 38 days and its time to drain those slutty balls of every last drop of man filth and then feed the bitch his protein the ladies just love the control they have over men pulling his filth from him at any time they, then making him eat every last drop.
Model:
Dava Foxx
Studio:
Clubdom.com
Info:
File Name : s669davakyliemilking.mp4
File Size : 450.77 MB
Resolution : 1280x720
Duration : 00:09:33

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/257fefdc53eec (https://tezfiles.com/file/257fefdc53eec)

Naeite
01-20-2022, 02:51 AM
Clubdom.com- Jean Bardot_s Sissy Training Part 1: Dress and Suck
https://img202.imagetwist.com/th/45077/0y8r1exb4ouc.jpg (https://imagetwist.com/0y8r1exb4ouc/cd_s1251_1-5_jean_sissytraining.jpg)
https://img202.imagetwist.com/th/45077/r212b3yam7tb.jpg (https://imagetwist.com/r212b3yam7tb/gYpdwV.jpg)

Description:
Jean Bardot feels that if this submissive is going to be a real sissy slut, then he needs to become a she and look the part. Jean brings in a rack of female clothes and chooses a very slutty outfit for the sissy slut to wear. Jean also puts a wig and make-up on her slut. Jean wants her sissy to learn how to be a good slut by sucking cock for her and she decides to instruct her sissy on just how it is done. She makes her sissy wrap her slutty lips around the large, throbbing cock and deep-throat it.
Model:
Jean Bardot
Studio:
Clubdom.com
Info:
File Name : cd_s1251_1-5_jean_sissytraining.mp4
File Size : 303.91 MB
Resolution : 1280x720
Duration : 00:06:30

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/d8a011c9b88ed (https://tezfiles.com/file/d8a011c9b88ed)

Naeite
01-20-2022, 02:58 AM
Clubdom.com- Whipping Their Pony Slave
https://img202.imagetwist.com/th/45075/gfet3g7npyzf.jpg (https://imagetwist.com/gfet3g7npyzf/cd_s1174_sashafoxx_reaganlush_whip.jpg)
https://img202.imagetwist.com/th/45075/qay409x1ijgj.jpg (https://imagetwist.com/qay409x1ijgj/SOXBwH.jpg)

Description:
Goddess Sasha Foxx and Reagan Lush are using their pony slave to pull them around when they stop him and have him start cleaning their boots. They want him to clean them good, paying close attention to the dirty bottoms of their boots. Reagan Lush tells him to suck the heel like a good little cocksucker. Reagan Lush gets bored with the boot worship, and asks Sasha Foxx if she would rather whip their pathetic pony slave bitch. They tie their slave to a tree and make him beg them to get whipped. Sasha Foxx cracks the whip across his back, turning it from pale pasty white to a deep crimson. Goddess Sasha Foxx feels like he isn_t getting the enjoyment out of this whipping that he should, and demands he beg for more. Reagan Lush then takes over using her red suede whip to sting against his back.
Model:
Reagan Lush, Sasha Foxx
Studio:
Clubdom.com
Info:
File Name : cd_s1174_sashafoxx_reaganlush_whip.mp4
File Size : 307.61 MB
Resolution : 1280x720
Duration : 00:06:31

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/1be4003f8784c (https://tezfiles.com/file/1be4003f8784c)

Naeite
01-20-2022, 03:02 AM
Clubdom.com- Golden Nectar Catcher
https://img119.imagetwist.com/th/44655/xlazjp8ffikh.jpg (https://imagetwist.com/xlazjp8ffikh/cd_01_13_13_peepov.jpg)
https://img119.imagetwist.com/th/44655/5kml1umz8ftd.jpg (https://imagetwist.com/5kml1umz8ftd/cd_01_13_13_peepov.mp4.jpg)

Description:
Goddess Amadahy and Mistress Coral tease you with their golden nectar, making you watch as they fill up a bowl for you to drool over. What would you do for the privilege of drinking it?
Model:
Coral, Goddess Amadahy
Studio:
Clubdom.com
Info:
File Name : cd_01_13_13_peepov.mp4
File Size : 38.79 MB
Resolution : 640x360
Duration : 00:04:43

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/b894e9eff72f9 (https://tezfiles.com/file/b894e9eff72f9)

Naeite
01-20-2022, 03:13 AM
Clubdom.com- Kate England StrapOn POV
https://img119.imagetwist.com/th/44832/3144mcbkpzu2.jpg (https://imagetwist.com/3144mcbkpzu2/s827kateenglandstraponpov.jpg)
https://img202.imagetwist.com/th/44832/dqd0ukka37u6.jpg (https://imagetwist.com/dqd0ukka37u6/CKzfNu.jpg)

Description:
Kate England tells you what she would do to you while she strokes her cock growing excited strapon, describing every hole she would fuck. All those tight slut holes that are wet and filthy ready to be fucked raw If you gag she will only thrust her cock deeper. Aroused by imagining your screams, she strokes faster. Just picture that big black strap-on filling you in every direction and punishing you from the inside.
Model:
Kate England
Studio:
Clubdom.com
Info:
File Name : s827kateenglandstraponpov.mp4
File Size : 249.33 MB
Resolution : 1280x720
Duration : 00:05:19

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/56fab37788104 (https://tezfiles.com/file/56fab37788104)

Naeite
01-20-2022, 03:14 AM
Clubdom.com- Tied Down and Trampling Balls
https://img202.imagetwist.com/th/44742/4mj9exy1if6q.jpg (https://imagetwist.com/4mj9exy1if6q/s453_ball_trampeling.jpg)
https://img119.imagetwist.com/th/44742/soxerm5hr966.jpg (https://imagetwist.com/soxerm5hr966/s453_ball_trampeling.mp4.jpg)

Description:
Club Dom features famous Mistresses from around the world engaging in slave training, corporal punishment, ball-busting, CBT, strap-on, and more.
Model:
Deanna Winters, Lizzie White, Nadia White
Studio:
Clubdom.com
Info:
File Name : s453_ball_trampeling.mp4
File Size : 281.53 MB
Resolution : 1280x720
Duration : 00:05:54

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/c431c5c4f0fbc (https://tezfiles.com/file/c431c5c4f0fbc)

Naeite
01-20-2022, 03:21 AM
Clubdom.com- Goddess Kendra Punishes the Bimbo
https://img119.imagetwist.com/th/45181/n2w6u4ygewd1.jpg (https://imagetwist.com/n2w6u4ygewd1/cd_1308_kendrajames_faceslap.jpg)
https://img202.imagetwist.com/th/45181/rrf49g2ay10e.jpg (https://imagetwist.com/rrf49g2ay10e/CKXDNBq.jpg)

Description:
Goddess Kendra is in the dungeon wearing her big black strap on cock. Her bimbo slave enters the room wearing a blonde wig and slutty fishnet stockings, black tiny mini skirt and a fishnet top. Goddess Kendra is upset by the rudeness of this slave. He is walking on his feet and looking her in the eye without permission. She orders the bitch to get on his knees beneath her where he belongs. The bimbo slave thinks that he is really sexy with pink lipstick on his lips. Goddess Kendra is appalled by the sloppiness of the lipstick. This bimbo slut wants and needs cock. But Kendra tells the slut that cock is a reward for him. Because of his behavior he doesnt deserve cock. Not yet at least Bad sissies need to be punished. Goddess Kendra slaps the slut across the face telling him that she wants a hot blond bimbo not a sloppy whore. Goddess Kendra makes the whore get on the spanking bench with his slutty ass sticking out in position for his paddling. Goddess Kendra gives this slut what he deserves, a hard paddling. Kendra is very stern and ignores her sissy slaves tears and screams. This is what it takes to train a proper bimbo.
Model:
Kendra James
Studio:
Clubdom.com
Info:
File Name : cd_1308_kendrajames_faceslap.mp4
File Size : 230.43 MB
Resolution : 1280x720
Duration : 00:04:50

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/250acba8e81ad (https://tezfiles.com/file/250acba8e81ad)

Naeite
01-20-2022, 03:26 AM
Clubdom.com- Denied Loser
https://img202.imagetwist.com/th/45060/dkpvn4fpoi69.jpg (https://imagetwist.com/dkpvn4fpoi69/cd_s667_full_eugene_bratt_doms.jpg)
https://img119.imagetwist.com/th/45060/5w02drdwkuln.jpg (https://imagetwist.com/5w02drdwkuln/XsAxQpa.jpg)

Description:
Bratty Doms Kylie Rogue and Dava Foxx notice that Eugene was jerking off his pathetic dick in the garage, so they decide to sneak up on him. As Mistress Kylie and Dava are standing behind him they decide to have a little fun with this nerdy loser. They force him in the cage and with this loser locked up, Mistress Kylie and Dava decide to tease him and make him smell their tight pink pussies and beautiful asses. Then they bring this poor pathetic loser Eugene into their dungeon to use him for their own pleasure, Helpless to the girls sexy little outfits and hot bodies Eudene agrees to do anything the ladies want. They strap him up with a dildo gag and instruct him to fuck their young wet pussies. Eugene pumps as hard and fast as he can and Dava cums then it_s right into Goddess Kylie she Fucks his face hard until she reaches orgasm.
Model:
Dava Foxx, Kylie Rogue
Studio:
Clubdom.com
Info:
File Name : cd_s667_full_eugene_bratt_doms.mp4
File Size : 716.83 MB
Resolution : 1280x720
Duration : 00:15:15

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/2ae9e961d6818 (https://tezfiles.com/file/2ae9e961d6818)

Naeite
01-20-2022, 03:33 AM
Clubdom.com- No Recovery Ball Busting
https://img202.imagetwist.com/th/45172/5zc14twih2gc.jpg (https://imagetwist.com/5zc14twih2gc/movie324cfsa.jpg)
https://img119.imagetwist.com/th/45172/hb4oamwf0b1m.jpg (https://imagetwist.com/hb4oamwf0b1m/ttnQYQ.jpg)

Description:
Lady Cheyenne begins with her bitch bent over and restrained. She attacks his balls from behind with repeated hard kicks. The slave is soon waning and cannot hold his weight in an upright position. Cheyenne releases him and begins kicking him again with FULL FORCE blows to his balls. There is no holding back. No mercy. No recovery time. Cheyenne kicks the slave until he is backed against a wall. She holds him up by his cock and punches his aching balls. Then she throws her bitch to the floor and begins kneeing and elbowing his balls. As the slave moans, motionless on the floor, Cheyenne twists his used up cock and balls up like a pretzel. She smacks his swollen balls several times over, laughing all the while. This is brute force ball busting with no mercy and no recovery time in between blows.
Model:
Teens girls, beautiful girl, milf
Studio:
Clubdom.com
Info:
File Name : movie324cfsa.mp4
File Size : 60.47 MB
Resolution : 640x480
Duration : 00:05:10

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/223b22ee366c1 (https://tezfiles.com/file/223b22ee366c1)

Naeite
01-20-2022, 03:34 AM
Clubdom.com- Veronica Cohen Kylie Rogue Caning
https://img202.imagetwist.com/th/44834/dv3rilbewk1l.jpg (https://imagetwist.com/dv3rilbewk1l/s832veronicacohenkylieroguecaning.jpg)
https://img33.imagetwist.com/th/44834/8wstqeq824lz.jpg (https://imagetwist.com/8wstqeq824lz/rLMdMw.jpg)

Description:
Mistress Veronica Cohen and Kylie Rogue play a game of rock paper scissors to see who will mark their slave first Veronica wins and wastes no time ordering her slave to stick out his ass to be caned. The Mistresses amuse each other by taking turns savagely caning the bitch. But now that the they are excited from vigorously punishing their slaves ass. Deciding to keep the lusty brutality, they tell the slave they are only leaving to grab their strap-ons
Model:
Kylie Rogue, Veronica Cohen
Studio:
Clubdom.com
Info:
File Name : s832veronicacohenkylieroguecaning.mp4
File Size : 418.91 MB
Resolution : 1280x720
Duration : 00:08:51

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/a71163942536b (https://tezfiles.com/file/a71163942536b)

Naeite
01-20-2022, 03:38 AM
Clubdom.com- Stretching Boy Pussy
https://img119.imagetwist.com/th/45050/kuhutnxtwt72.jpg (https://imagetwist.com/kuhutnxtwt72/cd_s1029_tangent_michellelacy_paulinaamore_strapon .jpg)
https://img202.imagetwist.com/th/45050/v7nqhwebat5w.jpg (https://imagetwist.com/v7nqhwebat5w/qxXIUHDL.jpg)

Description:
Michelle Lacy, Goddess Tangent and Paulina Amore have Paulina_s new boyfriend in their stable of slaves. He knees, along with two others, ready to feel what real submission is, as he gets his holes stretched and fucked by Paulina, alongside the other slaves. The women shove their huge cocks inside the mouths of their slaves, and make them gag for a bit, while they laugh and verbally taunt them. Before long, it is a total strap-on fuck-fest as the Mistresses obliterate their holes, fucking them deep, fast, and hard, stretching out their boy pussies
Model:
Goddess Tangent, Michelle Lacy, Paulina Amore
Studio:
Clubdom.com
Info:
File Name : cd_s1029_tangent_michellelacy_paulinaamore_strapon .mp4
File Size : 385.97 MB
Resolution : 1280x720
Duration : 00:08:11

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/4168bd48cfa08 (https://tezfiles.com/file/4168bd48cfa08)

Naeite
01-20-2022, 03:40 AM
Clubdom.com- 3 Mistresses CBT Caning Slave
https://img33.imagetwist.com/th/44743/sodh8hxj4xkj.jpg (https://imagetwist.com/sodh8hxj4xkj/s455_cbt_caning.jpg)
https://img33.imagetwist.com/th/44743/jqn4cypjq2zv.jpg (https://imagetwist.com/jqn4cypjq2zv/s455_cbt_caning.mp4.jpg)

Description:
Club Dom features famous Mistresses from around the world engaging in slave training, corporal punishment, ball-busting, CBT, strap-on, and more.
Model:
Deanna Winters, Lizzie White, Nadia White
Studio:
Clubdom.com
Info:
File Name : s455_cbt_caning.mp4
File Size : 323.13 MB
Resolution : 1280x720
Duration : 00:06:51

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/0aec5cbaaffd6 (https://tezfiles.com/file/0aec5cbaaffd6)

Naeite
01-20-2022, 03:41 AM
Clubdom.com- Michelle_s Pleasure Slave
https://img202.imagetwist.com/th/45076/veuuduyqjame.jpg (https://imagetwist.com/veuuduyqjame/cd_s1012_full_michellelacy.jpg)
https://img202.imagetwist.com/th/45076/2w9he5d4fij8.jpg (https://imagetwist.com/2w9he5d4fij8/RsHPqm.jpg)

Description:
Mistress Michelle Lacy is away from the Club Dom estate, and enjoying herself alone with her slave. She has a bedroom turned into a dungeon which she will use to torment and train her slave in order to mold him into her most obedient pleasure puppet. She has her slave locked in a cage. You are in for a real treat today slave. Today you get to worship my sweet pussy. The last slave didn_t do it for me and I have been pent-up ever since She shoves her leather gloved finger across her wet pussy and makes him smell it. She then takes him out of the cage and shows him her pussy. She makes him worship her boots in order to get her pussy wet. She smashes a flogger on him and commands him to do it better. I said LICK she demands.The boot slave continues to lick her boots, suck on the heel, cleans the bottoms and does as she demands. She then stops him and forces him to eat her pussy. She moans but he isn_t doing a very good job. She has to get herself off with her vibrator and decides she is going to make him suffer horribly for screwing up. Michelle is unhappy that she was not pleasured well enough when she finally had given her slave the chance to prove himself. Now he is in for a punishment he will not soon forget. Michelle decides that she wants him to suffer and she will start by punishing his cock. Michelle crops her slave_s cock repeatedly and hard while scolding him and showing him that he could have had his chance to pleasure her and he blew it. She punishes and scolds him while he winces in pain, his cock getting more bruised by the second. Michelle is now going to whip her slave for failing to pleasure her. She already bruised up his cock and not she wants to do the same to his back. Michelle whips her slave while threatening him. If I wasn_t thinking about using you as a human dildo later, I might have taken all of your skin off she says about his cock. Michelle makes the slave suffer with each lash. Then she admires his lashes and with her leather gloved hand, makes him taste her wet pussy. Michelle Lacy tells her slave that he is not worthy of ever licking her pussy again, he only gets to lick her ass and the sweat that comes off of it. Michelle forces her slave to lick her ass while she plays with herself with her sexy leather gloved fingers. Michelle moans and tells her slave that he better not screw up again, or else a lot more punishment is in store. If he is a good boy, he might be used as a human dildo later. Mistress Michelle Lacy knows that you SHOULD be locked up in a chastity device since you are so horny and disobedient and cannot stop touching yourself. But since you are unlocked, she is going to make you stroke your pathetic excuse for a cock for her, exactly the way she wants you to, while she teases you. She will tell you about how her slaves are trained and would never dream of touching their cock for fear of what she might do to them if they did without her permission, and that is going to eventually be what YOUR future holds since you just cannot control yourself. So show Michelle how you obey her now, and that she now controls your cock and owns your cock. Do as she says. Mistress Michelle Lacy decides she is going to use her slave_s cock as a human dildo, as she is extremely horny after all of the punishment she gave him. If he is so awful at eating pussy, then perhaps his huge cock can pleasure her. He of course, is not allowed to cum. Not only, is his cock is throbbing with pain and bruised from Michelle cropping it from when she punished him earlier, but Michelle has tied up her slave_s balls very tightly, cutting off his circulation and making him extremely numb, making it impossible for him to cum even if he wanted to. Michelle makes her slave lay down on his lashed back from the whipping she gave him and she uses his cock to get her off. She then strokes his very hard, frustrated cock, getting him close, and then taking it all away by stopping, on top of the numbness. The slave is left in a state of frustration but he has little power to stop it. He must do as she says. Then Michelle decides to use him as a dildo and makes herself cum by riding his very hard, big cock. After she cums, she gives the slave a hand job and gives him a few minutes to cum. However, with that rope tied around, it will be difficult. She strokes him right to the edge and yet he cannot cum. He tries, but he just can_t. She continues to stroke and he is just frustrated.
Model:
Michelle Lacy
Studio:
Clubdom.com
Info:
File Name : cd_s1012_full_michellelacy.mp4
File Size : 1734.62 MB
Resolution : 1280x720
Duration : 00:36:42

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/ec9f3452ff8b2 (https://tezfiles.com/file/ec9f3452ff8b2)

Naeite
01-20-2022, 03:44 AM
Clubdom.com- Stella Liberty Destroys Balls
https://img202.imagetwist.com/th/45081/amiuwh67bwk7.jpg (https://imagetwist.com/amiuwh67bwk7/cd_s1294_stellaliberty_cbt.jpg)
https://img119.imagetwist.com/th/45081/bk12b5ee86oo.jpg (https://imagetwist.com/bk12b5ee86oo/hWtYRoIB.jpg)

Description:
Stella Liberty continues her torment competition between her two potential slaves. The sissy slave is forced to watch, kneeling in the corner holding Stellas glass of wine, the CBT work of Stella on the pain slut. Stella is quite creative with her torment, while having his cock and balls bound, she has an empty container tethered to his outstretched balls. Cruelly, as she abuses his cock with her crop, she fills the container with water, further stretching his balls and limits simultaneously. Without mercy she torments his otherwise useless cock and balls. His cries out only further her enjoyment. All the while planning for the next stage of his torture
Model:
Stella Liberty
Studio:
Clubdom.com
Info:
File Name : cd_s1294_stellaliberty_cbt.mp4
File Size : 287.94 MB
Resolution : 1280x720
Duration : 00:06:04

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/206c4d5a9559d (https://tezfiles.com/file/206c4d5a9559d)

Naeite
01-20-2022, 03:50 AM
Clubdom.com- Whipped by Goddess Brianna
https://img119.imagetwist.com/th/45075/fw1emc0qfk8r.jpg (https://imagetwist.com/fw1emc0qfk8r/cd_s1249_brianna_whipping.jpg)
https://img119.imagetwist.com/th/45075/yexq2awro2u5.jpg (https://imagetwist.com/yexq2awro2u5/rDRkgQj.jpg)

Description:
Goddess Brianna is in the mood to give her slave a brutal whipping. He is trained to suffer for her and he understands his place. He is ready to take every painful lash so he can wear the lashes proudly. Goddess Brianna is very strict and she gives him a bunch of nasty lashes with the dragon tail. That was just his warm up as a single tail is next. The more he screams, the more she smiles, like a true sadist.&nbsp
Model:
Goddess Brianna
Studio:
Clubdom.com
Info:
File Name : cd_s1249_brianna_whipping.mp4
File Size : 388.64 MB
Resolution : 1280x720
Duration : 00:08:09

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/fb2c0e8405457 (https://tezfiles.com/file/fb2c0e8405457)

Naeite
01-20-2022, 03:55 AM
Clubdom.com- Butt Fucking The Losers
https://img119.imagetwist.com/th/44668/sxpf2sb8qgbn.jpg (https://imagetwist.com/sxpf2sb8qgbn/strapmacyal.jpg)
https://img33.imagetwist.com/th/44668/ion6lyq18zya.jpg (https://imagetwist.com/ion6lyq18zya/strapmacyal.mp4.jpg)

Description:
Mistress Macy and Goddess Alexis are gonna have some more fun with the loser boys. The Mistress already have control of Tiny Dick its time for Thor Tiny Dicks trainer to become their new bitch. The Mistress_s are wearing large black cocks and are going to make the losers lube them up with there mouths. The mistress_s force the losers on there knees and shove there large black dongs deep down there throats. After Tiny Dick and Thor give the Mistress_s cocks good blowjobs its time for some anal abuse. The Mistress_s each take one loser and stick there cock deep in there man pussy_s. The Mistresses brutally butt fuck the losers and spare no mercy. After the Mistress_s have had there fun with the losers assholes the Mistress_s are done with them. The Mistress_s will need to have there cocks cleaned before they go. The Mistresses force the losers back on there knees and make losers clean there cocks by sucking all there man juices up with there mouths.
Model:
Macy Cartel
Studio:
Clubdom.com
Info:
File Name : strapmacyal.mp4
File Size : 170.14 MB
Resolution : 640x360
Duration : 00:07:37

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/4060f200016d2 (https://tezfiles.com/file/4060f200016d2)

Naeite
01-20-2022, 03:58 AM
Clubdom.com- No mercy brutal Spanking
https://img33.imagetwist.com/th/44667/6np6215xtrtm.jpg (https://imagetwist.com/6np6215xtrtm/nomercybrutalspanking.jpg)
https://img33.imagetwist.com/th/44667/h2kzbpmms5a6.jpg (https://imagetwist.com/h2kzbpmms5a6/nomercybrutalspanking.mp4.jpg)

Description:
Mistress Coral orders her slave in. Mistress Coral is furious The slave has not been doing his duties and needs to be punished. Coral slaps him like a little bitch over and over and demands he take off his pants Since the slave wants to act like a little boy he will be treated like a little boy Coral bends him over her lap and brutally spanks his ass. Coral beats his ass non stop till its black and blue and red welts form. Coral is sick of his crap and lets him know. The slave screams in agony. Coral will will not be giving any mercy and spanks him harder with every scream. Mistress Coral has her temper with this slave and takes it out on his ass. The slave cannot take anymore but Coral continues her assault on his bare ass. Coral is done with the slave and she orders him to the ground to kiss her shoes. Coral then forces him back up so she can violently slap his face some more before sending the slave away.
Model:
Coral
Studio:
Clubdom.com
Info:
File Name : nomercybrutalspanking.mp4
File Size : 125.62 MB
Resolution : 640x360
Duration : 00:05:37

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/5585815a36950 (https://tezfiles.com/file/5585815a36950)

Naeite
01-20-2022, 04:06 AM
Clubdom.com- Merciless Ass Pounding
https://img202.imagetwist.com/th/44653/lff0btsqn8qk.jpg (https://imagetwist.com/lff0btsqn8qk/cd_scene_12_16_12_strapon.jpg)
https://img33.imagetwist.com/th/44653/iz10a6q3aupb.jpg (https://imagetwist.com/iz10a6q3aupb/cd_scene_12_16_12_strapon.mp4.jpg)

Description:
Goddess Amadahy and Mistress Kendra mercilessly pound this bitch_s ass with their cocks. While the Amazon Amadahy pounds the slave with her huge strapon, making him take it balls deep, Kendra makes him gag on her cock until he is gagging on it, drool pouring out of his mouth.

When Amadahy has had enough of fucking their slave, Kendra takes over fucking the slut_s ass while Amadahy now makes him suck on her cock, now covered in his ass juices. The Mistresses inspect his blown out ass, telling him that they will be fucking him even harder next time.
Model:
Goddess Amadahy, Kendra James
Studio:
Clubdom.com
Info:
File Name : cd_scene_12_16_12_strapon.mp4
File Size : 53.59 MB
Resolution : 640x360
Duration : 00:06:43

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/2840483d2cafa (https://tezfiles.com/file/2840483d2cafa)

Naeite
01-20-2022, 04:09 AM
Clubdom.com- Cum, and it_s Castration
https://img202.imagetwist.com/th/45080/g9xswginlugg.jpg (https://imagetwist.com/g9xswginlugg/cd_s1267_sadieholmes_fuckingcastration.jpg)
https://img119.imagetwist.com/th/45080/f1uowi62chn9.jpg (https://imagetwist.com/f1uowi62chn9/uBllecg.jpg)

Description:
Goddess Sadie Holmes is actually going to fuck her slave. She is actually going to allow him to be inside of her. He must have really impressed her, plus, it_s a waste of a big cock. Sadie has one condition and that is the slave is NOT allowed to cum. If he does, she is going to take his balls. That_s correct, she is going to take his pathetic balls right off of him via castration Sadie moans with pleasure as she is fucked by the big cocked slave.
Model:
Sadie Holmes
Studio:
Clubdom.com
Info:
File Name : cd_s1267_sadieholmes_fuckingcastration.mp4
File Size : 377.6 MB
Resolution : 1280x720
Duration : 00:08:00

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/ffb4b19737de6 (https://tezfiles.com/file/ffb4b19737de6)

Naeite
01-20-2022, 04:27 AM
Clubdom.com- Better Off As A Woman
https://img33.imagetwist.com/th/44654/uk74o56nu01j.jpg (https://imagetwist.com/uk74o56nu01j/cd_12_16_12_sissytransform.jpg)
https://img165.imagetwist.com/th/44654/20z57gckejzk.jpg (https://imagetwist.com/20z57gckejzk/cd_12_16_12_sissytransform.mp4.jpg)

Description:
Mistress Kendra and Goddess Amadahy are totally dissatisfied with their slave as a man with such a small and inadequate penis, no real woman would have a use for him. As they toy with his cock, the Mistresses give him the news - they have decided to turn him into a woman
Model:
Goddess Amadahy, Kendra James
Studio:
Clubdom.com
Info:
File Name : cd_12_16_12_sissytransform.mp4
File Size : 53.43 MB
Resolution : 640x360
Duration : 00:06:38

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/db8130e85046b (https://tezfiles.com/file/db8130e85046b)

Naeite
01-20-2022, 04:30 AM
Clubdom.com- Jean Friend Humiliate Losers Full
https://img119.imagetwist.com/th/45180/3fuvxozurk62.jpg (https://imagetwist.com/3fuvxozurk62/cd_s144_minimovie_v2.jpg)
https://img202.imagetwist.com/th/45180/7mo0ruwunqfn.jpg (https://imagetwist.com/7mo0ruwunqfn/ZlYkfZLZ.jpg)

Description:
Club Dom features famous Mistresses from around the world engaging in slave training, corporal punishment, ball-busting, CBT, strap-on, and more.
Model:
Face Slapping, Full Movie, Spitting
Studio:
Clubdom.com
Info:
File Name : cd_s144_minimovie_v2.mp4
File Size : 853.26 MB
Resolution : 1280x720
Duration : 00:18:07

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/1dadca2eb4047 (https://tezfiles.com/file/1dadca2eb4047)

Naeite
01-20-2022, 04:33 AM
Clubdom.com- So Pathetic
https://img119.imagetwist.com/th/44654/8j8gofywyplh.jpg (https://imagetwist.com/8j8gofywyplh/cd_12_31_12_femdompov.jpg)
https://img202.imagetwist.com/th/44654/6k5zia18degh.jpg (https://imagetwist.com/6k5zia18degh/cd_12_31_12_femdompov.mp4.jpg)

Description:
Mistress Elena knows how pathetic you feel, looking at her hot body and wishing you could worship it. Just look at her ass - how much do you want to worship it? Start stroking your little cock and show her how much you want the privilege of being her ass bitch.

Speaking of asses, how about defiling your own? Shove a finger up your ass, then clean your filth off of it - just for Elena to laugh at how pathetic her beauty makes you. Two fingers now - you get the idea. Keep going until you have your entire hand in your ass. Maybe by proving how pathetic you are, you might earn the privilege of groveling before this beautiful Mistress.
Model:
Elena Sin
Studio:
Clubdom.com
Info:
File Name : cd_12_31_12_femdompov.mp4
File Size : 43.72 MB
Resolution : 640x360
Duration : 00:05:28

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/547438a8fb229 (https://tezfiles.com/file/547438a8fb229)

Naeite
01-20-2022, 04:43 AM
Clubdom.com- Coral and Cheyenne_s Spitoon
https://img202.imagetwist.com/th/45079/4388s6v8a2ca.jpg (https://imagetwist.com/4388s6v8a2ca/cd_s72_face_spitting.jpg)
https://img119.imagetwist.com/th/45079/hlosoenq5p8g.jpg (https://imagetwist.com/hlosoenq5p8g/zhcvmlPp.jpg)

Description:
Coral and Lady Cheyenne use their caged slave as a spittoon for them. There is absolutely nothing he can do but open up and swallow.
Model:
Coral, Lady Cheyenne
Studio:
Clubdom.com
Info:
File Name : cd_s72_face_spitting.mp4
File Size : 325.22 MB
Resolution : 1280x720
Duration : 00:06:49

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/04011a29b2e3a (https://tezfiles.com/file/04011a29b2e3a)

Naeite
01-20-2022, 04:45 AM
Clubdom.com- Dahila Rain Harlow StrapOn Fucking
https://img202.imagetwist.com/th/45051/rvlc3smr5ytb.jpg (https://imagetwist.com/rvlc3smr5ytb/cd_s1055_dahliaharlow_pegging.jpg)
https://img202.imagetwist.com/th/45051/awm3xp48slrj.jpg (https://imagetwist.com/awm3xp48slrj/LsnLKqM.jpg)

Description:
Club Dom features famous Mistresses from around the world engaging in slave training, corporal punishment, ball-busting, CBT, strap-on, and more.
Model:
Dahlia Rain, Harlow Harrison
Studio:
Clubdom.com
Info:
File Name : cd_s1055_dahliaharlow_pegging.mp4
File Size : 296.12 MB
Resolution : 1280x720
Duration : 00:06:20

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/99fb1f9d13970 (https://tezfiles.com/file/99fb1f9d13970)

Naeite
01-20-2022, 04:49 AM
Clubdom.com- Goddess Valora Demands Obedience: Caning
https://img119.imagetwist.com/th/45182/3v9up6l7z52w.jpg (https://imagetwist.com/3v9up6l7z52w/cd_s1349_valora_caning.jpg)
https://img119.imagetwist.com/th/45182/e2uh4kcyqbm5.jpg (https://imagetwist.com/e2uh4kcyqbm5/gxJWWc.jpg)

Description:
Goddess Valora is in the mood to punish her slave today. She expects her slaves to behave properly and to follow her protocols at all times. Goddess Valora tells her bitch to get in to position and present his ass for caning. She is a very strict Mistress that demands respect. But as she canes her slaves ass she cant help but to laugh and smile. Her smile turns to anger when her slave does not keep his ass out in the proper position though. After warming up her slaves backside with her cane strokes, Goddess Valora rewards him by spitting in his mouth. She then puts him into bondage with his hands secured above him, standing on the punishment platform. She wouldnt want her slave trying to get away from her vicious beating Her slave cries and begs for mercy but the caning continues. Finally, Goddess Valora is satisfied with his punishment and checks out all the red stripes and bruises on her slaves ass and legs. Thats what happens when slaves dont stay in position and move too much, Goddess Valora tells the bitch. She then tells him that she has more planned for today. He might even get fucked. Just not in the conventional way
Model:
Goddess Valora
Studio:
Clubdom.com
Info:
File Name : cd_s1349_valora_caning.mp4
File Size : 381.46 MB
Resolution : 1280x720
Duration : 00:08:03

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/0347d71f19c5e (https://tezfiles.com/file/0347d71f19c5e)

Naeite
01-20-2022, 04:56 AM
Clubdom.com- Raven Isobel: Stuffed and Humiliated for Young Mistresses
https://img202.imagetwist.com/th/45044/ttviz1gatoe6.jpg (https://imagetwist.com/ttviz1gatoe6/s919ravenisobelrickystrapon.jpg)
https://img119.imagetwist.com/th/45044/rg1tj78grcfw.jpg (https://imagetwist.com/rg1tj78grcfw/borypvr.jpg)

Description:
Poor slave is all strung up and helpless in the most VULNERABLE position. The three young Mistresses lead by Mistress Isobel Devi, take turns stuffing his fuck-holes, making him lick their boots and kicking his pathetic useless cock and balls. The three young women look so incredibly hot as they laugh and encourage each other to destroy the piece of man meat strung up before them. Mistress Ricky and Mistress Raven have learned so much about the ways of femdom and know this is how life is supposed to be and that men are just pieces of meat to serve them.
Model:
Isobel Devi, Raven Bay
Studio:
Clubdom.com
Info:
File Name : s919ravenisobelrickystrapon.mp4
File Size : 386.62 MB
Resolution : 1280x720
Duration : 00:07:06

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/047c291882b81 (https://tezfiles.com/file/047c291882b81)

Naeite
01-20-2022, 04:58 AM
Clubdom.com- 30 Day Milking
https://img69.imagetwist.com/th/44820/2fg66e7603h7.jpg (https://imagetwist.com/2fg66e7603h7/s493_stevie_shae_kelly_diamond_brianna_milking.jpg )
https://img165.imagetwist.com/th/44821/2t3zjm2p9tj5.jpg (https://imagetwist.com/2t3zjm2p9tj5/mMcDoo.jpg)

Description:
Steive Shae, Goddess Brianna and Kelly Diamond ascend upon a bound slut. They hold the slut_s balls and stroke his cock. It is time for his 30 day milking. The male bitch resists. He knows that as soon as his male filth is extracted, Brianna will pinch the base of his balls in such a way to prevent a full orgasm. A ruined orgasm is worse than no orgasm at all It is out right painful The bitch tries to resist put the ladies coax the orgasm right out of him. Stevie laughs as the male bitch winces in pain, See you in another 30 days, bitch She smiles.
Model:
Goddess Brianna, Kelly Diamond, Stevie Shae
Studio:
Clubdom.com
Info:
File Name : s493_stevie_shae_kelly_diamond_brianna_milking.mp4
File Size : 265.91 MB
Resolution : 1280x720
Duration : 00:05:38

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/4216701ae7c94 (https://tezfiles.com/file/4216701ae7c94)

Naeite
01-20-2022, 04:59 AM
Clubdom.com- Whipping From Female Supremaci
https://img165.imagetwist.com/th/44827/02lx5dud2na7.jpg (https://imagetwist.com/02lx5dud2na7/cds694kendralydiawhipping.jpg)
https://img119.imagetwist.com/th/44827/edgf5egmlqgz.jpg (https://imagetwist.com/edgf5egmlqgz/bHzlKr.jpg)

Description:
A new slave has been purchased at Club Dom and Goddesses Lydia Supremacy and Kendra James are just the Women to break the new meat in Already bruised and beaten from a prior caning, the slave is suspended hands over head with his legs held apart with a spreader bar, unable to move or avoid the torments of his Goddesses. Amused, both Mistresses torment and taunt the slave, before tearing into him with their whips. The lashes stripe his back in a furious frenzy of strokes, paining a beautiful canvas for all to admire. Overcome by pain, the slave dances about in a feeble attempt to avoid the pain brought on by the vicious whips. A ridiculous exhibition is put on by the slave, who appears to even be tweaking his buttocks in an attempt to gain some mercy from the dreaded whips. However, as all slaves eventually learn, there is never any mercy for male filth at Club Dom. Goddess Kendra and Lydia both admire their handiwork as they dig their nails into the tender, battered flesh of their new subordinate, causing him to wince and cry out in even more extreme pain. Just another day at Club Dom.
Model:
Kendra James, Lydia Supremacy
Studio:
Clubdom.com
Info:
File Name : cds694kendralydiawhipping.mp4
File Size : 317.63 MB
Resolution : 1280x720
Duration : 00:06:44

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/d3abeb04dc56c (https://tezfiles.com/file/d3abeb04dc56c)

Naeite
01-20-2022, 05:06 AM
Clubdom.com- Sully Savage StrapOn
https://img119.imagetwist.com/th/45085/8h4rkomgljw1.jpg (https://imagetwist.com/8h4rkomgljw1/cd_s1304_sullysavage_strapon.jpg)
https://img119.imagetwist.com/th/45085/dov31djw1m59.jpg (https://imagetwist.com/dov31djw1m59/uIzFCSJ.jpg)

Description:
Club Dom features famous Mistresses from around the world engaging in slave training, corporal punishment, ball-busting, CBT, strap-on, and more.
Model:
Sully Savage
Studio:
Clubdom.com
Info:
File Name : cd_s1304_sullysavage_strapon.mp4
File Size : 317.19 MB
Resolution : 1280x720
Duration : 00:06:39

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/170f4a7b37eef (https://tezfiles.com/file/170f4a7b37eef)

Naeite
01-20-2022, 05:14 AM
Clubdom.com- Cock and Balls in Trouble
https://img202.imagetwist.com/th/44742/tuopr9ppuc48.jpg (https://imagetwist.com/tuopr9ppuc48/s442_cbt.jpg)
https://img202.imagetwist.com/th/44742/79sjo6v6ny0b.jpg (https://imagetwist.com/79sjo6v6ny0b/s442_cbt.mp4.jpg)

Description:
Michelle Lacy, Eden Alexandrea and Kimmylee have a male bitch bound in a precarious positions. His hands are restrained over his head, suspending him just to the tips of his toes. The bitch_s cock and balls are locked into a wooden vice before him. His balls are covered in clothes pins. The ladies are amused with this vulnerable position. How helpless the slut is to protect his balls. The ladies take riding crops to the _ balls and smack a few clothes pins off his aching nipples. After the clothes pins are gone, Eden takes a few more whacks at his aching and swollen balls with her riding ride. The ladies are simply glowing as they enjoy torturing this helpless slut.
Model:
Eden Alexander, Kimmylee, Michelle Lacy
Studio:
Clubdom.com
Info:
File Name : s442_cbt.mp4
File Size : 270.47 MB
Resolution : 1280x720
Duration : 00:05:42

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/63f7bbc285ed4 (https://tezfiles.com/file/63f7bbc285ed4)

Naeite
01-20-2022, 05:33 AM
Clubdom.com- Milking The Sex Slave
https://img119.imagetwist.com/th/45074/korzdukmh2nz.jpg (https://imagetwist.com/korzdukmh2nz/cd_s1236_evelinstone_tuckerstevens_handjob.jpg)
https://img202.imagetwist.com/th/45074/83t3phhgaaxn.jpg (https://imagetwist.com/83t3phhgaaxn/ZsNmesrU.jpg)

Description:
Mistress Evelin Stone and Goddess Tucker Stevens decide on milking day that they are going to milk their sex slave. Maybe if he drains his filth out of his slut sack, he will be more even tempered and well behaved around here, not to mention, will be less likely to cum when he isn_t supposed to. If he is going to be kept alive around here, he must spill his filth no matter how humiliating it is to do so, strung up and at the hands of two controlling young women. Of course they make him eat his filth, because cumming comes at a price.
Model:
Evelin Stone, Tucker Stevens
Studio:
Clubdom.com
Info:
File Name : cd_s1236_evelinstone_tuckerstevens_handjob.mp4
File Size : 279.96 MB
Resolution : 1280x720
Duration : 00:05:55

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/dcbad7937af91 (https://tezfiles.com/file/dcbad7937af91)

Naeite
01-20-2022, 05:36 AM
Clubdom.com- Beat up by 2 Goddesses Part 4
https://img165.imagetwist.com/th/44821/as8sln3f8m7s.jpg (https://imagetwist.com/as8sln3f8m7s/s512_minimovie_cheyenne_jewel_amadahy_part4.jpg)
https://img69.imagetwist.com/th/44821/p2yaiqyfw3rp.jpg (https://imagetwist.com/p2yaiqyfw3rp/lAOVfzkd.jpg)

Description:
Cheyenne Jewel and Amadahy have ruthlessly emasculated a self proclaimed wrestling champ, by completely over taking him on the mat. Now, they drive their point home, literally. Cheyenne and Amadayhe bring out their strap on cocks and fuck this loser ruthlessly, shoving their cocks in his mouth and in his now proclaimed man pussy. Cheyenne and Amadayhe take turns holding this male bitch in place with their strong thighs as they nail him like the worthless whore he is.
Model:
Cheyenne Jewel, Goddess Amadahy
Studio:
Clubdom.com
Info:
File Name : s512_minimovie_cheyenne_jewel_amadahy_part4.mp4
File Size : 261.7 MB
Resolution : 1280x720
Duration : 00:05:32

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/5bf4d5c3adca1 (https://tezfiles.com/file/5bf4d5c3adca1)

Naeite
01-20-2022, 05:38 AM
Clubdom.com- Nikki Brooks Caning a Helpless Man
https://img202.imagetwist.com/th/45053/3j7zb4ocndr6.jpg (https://imagetwist.com/3j7zb4ocndr6/cd_s1070_nikkibrooks_caning.jpg)
https://img119.imagetwist.com/th/45053/sp5ndovgj3rw.jpg (https://imagetwist.com/sp5ndovgj3rw/tSKMrM.jpg)

Description:
Club Dom features famous Mistresses from around the world engaging in slave training, corporal punishment, ball-busting, CBT, strap-on, and more.
Model:
Nikki Brooks
Studio:
Clubdom.com
Info:
File Name : cd_s1070_nikkibrooks_caning.mp4
File Size : 299.15 MB
Resolution : 1280x720
Duration : 00:06:20

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/1fd9d12905a9d (https://tezfiles.com/file/1fd9d12905a9d)

Naeite
01-20-2022, 05:39 AM
Clubdom.com- Alexis Fawx Chindo Worshipped
https://img33.imagetwist.com/th/44830/xdkfvutnva53.jpg (https://imagetwist.com/xdkfvutnva53/s7894-4alexisfawxchindo.jpg)
https://img202.imagetwist.com/th/44830/c8ywdgzp2096.jpg (https://imagetwist.com/c8ywdgzp2096/iVvCPL.jpg)

Description:
Goddess Alexis Fawx is feeling horny and enters the dungeon with slave crawling in front of her as she shocks the slut with her cattle prod laughing at how far the bitch jumps every time she shocks him, She lays him on his back and places her thigh high boot on his chest, and spreads her legs, informing him that he must get her off, She attaches a chindo to his face and tells him to fuck her pussy hard, The slaves head is bouncing up and down like a basketball as she yells harder bitch, The pathetic slut can_t get her off, So she lays him back on a bench and decides he will be her human dildo, She spits on his cock face, and begins to grind her pussy all over his dick face she fucks the bitch till she reaches orgasm, Then smacks him in the face and says if she wants anything done right, She just has to do it herself, Your pathetic and useless.
Model:
Alexis Fawx
Studio:
Clubdom.com
Info:
File Name : s7894-4alexisfawxchindo.mp4
File Size : 319.73 MB
Resolution : 1280x720
Duration : 00:06:45

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/8713a2b582dee (https://tezfiles.com/file/8713a2b582dee)

Naeite
01-20-2022, 05:46 AM
Clubdom.com- Alexis Fawx Parker Full Movie
https://img119.imagetwist.com/th/45177/p1zb1okbk6rz.jpg (https://imagetwist.com/p1zb1okbk6rz/cd_s951_full_alexisfawx_parkerswayze.jpg)
https://img202.imagetwist.com/th/45177/j5unm7bom1iv.jpg (https://imagetwist.com/j5unm7bom1iv/QxaSjS.jpg)

Description:
Club Dom features famous Mistresses from around the world engaging in slave training, corporal punishment, ball-busting, CBT, strap-on, and more.
Model:
Alexis Fawx, Parker Swayze
Studio:
Clubdom.com
Info:
File Name : cd_s951_full_alexisfawx_parkerswayze.mp4
File Size : 990.66 MB
Resolution : 1280x720
Duration : 00:20:54

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/32e784f3aa882 (https://tezfiles.com/file/32e784f3aa882)

Naeite
01-20-2022, 05:46 AM
Clubdom.com- You Are Esmi And Kendra Caged Slave
https://img119.imagetwist.com/th/44716/14r6c4e13152.jpg (https://imagetwist.com/14r6c4e13152/yourareesmiandkendracagedslave.jpg)
https://img119.imagetwist.com/th/44716/rmvnvwih0lm9.jpg (https://imagetwist.com/rmvnvwih0lm9/yourareesmiandkendracagedslave.mp4.jpg)

Description:
Mistress Kendra And Mistress Esmi have you in there cage. The Mistress_s make you stroke your cock to them. The Mistress first edge you and do not allow you to cum till they tell you. The Mistress_s make you hump the cage causing the metal to cause you discomfort and pain. Finally the Mistress let you cum but every drip must be eaten.
Model:
Esmi Lee, Kendra James
Studio:
Clubdom.com
Info:
File Name : yourareesmiandkendracagedslave.mp4
File Size : 153.31 MB
Resolution : 640x360
Duration : 00:04:59

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/d6f3de5ee441c (https://tezfiles.com/file/d6f3de5ee441c)

Naeite
01-20-2022, 05:57 AM
Clubdom.com- Caught By the Guardesses Part 3: Fuck Toy
https://img119.imagetwist.com/th/45047/u6vq34s2c3cx.jpg (https://imagetwist.com/u6vq34s2c3cx/cd_s956_jamievalentine_paris_straponslave.jpg)
https://img202.imagetwist.com/th/45047/56efq1kcrsoh.jpg (https://imagetwist.com/56efq1kcrsoh/syHcehg.jpg)

Description:
The Guardesses actually do not need any information out of their spy as they were already informed of everything they need to know. they decide due to the size of his cock, they will keep him around and use him for sex. He must pleasure them or else. Paris decides she wants a ride and tests out their new slave_s cock. He must make her cum or Jamie will most likely take his balls.
Model:
Jamie Valentine
Studio:
Clubdom.com
Info:
File Name : cd_s956_jamievalentine_paris_straponslave.mp4
File Size : 254.58 MB
Resolution : 1280x720
Duration : 00:05:24

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/97f564f7798b7 (https://tezfiles.com/file/97f564f7798b7)

Naeite
01-20-2022, 06:05 AM
Clubdom.com- Michelle_s Pleasure Slave 2: Cropped and Punished
https://img119.imagetwist.com/th/45050/bhnp3i2btx5x.jpg (https://imagetwist.com/bhnp3i2btx5x/cd_s1012_2-6_michellelacy_cbt.jpg)
https://img202.imagetwist.com/th/45050/ofnrpaygvxqw.jpg (https://imagetwist.com/ofnrpaygvxqw/MNEnFDQk.jpg)

Description:
Michelle is unhappy that she was not pleasured well enough when she finally had given her slave the chance to prove himself. Now he is in for a punishment he will not soon forget. Michelle decides that she wants him to suffer and she will start by punishing his cock. Michelle crops her slave_s cock repeatedly and hard while scolding him and showing him that he could have had his chance to pleasure her and he blew it. She punishes and scolds him while he winces in pain, his cock getting more bruised by the second.
Model:
Michelle Lacy
Studio:
Clubdom.com
Info:
File Name : cd_s1012_2-6_michellelacy_cbt.mp4
File Size : 273.68 MB
Resolution : 1280x720
Duration : 00:05:48

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/3d86733d2ccdd (https://tezfiles.com/file/3d86733d2ccdd)

Naeite
01-20-2022, 06:07 AM
Clubdom.com- Edging To The Brink Of Insanity
https://img202.imagetwist.com/th/44716/tbkwznxpswj4.jpg (https://imagetwist.com/tbkwznxpswj4/edgingtothebrinkofinsanity.jpg)
https://img202.imagetwist.com/th/44716/rj9etdm967rx.jpg (https://imagetwist.com/rj9etdm967rx/edgingtothebrinkofinsanity.mp4.jpg)

Description:
The Mistress are here to have some fun with there bound slave. The Mistress are going to milk this poor slave but not before they torture him first. The Mistress are going to slow tease jerk and edge his cock. The Mistress get the slave to the point of cumming then stop making him go insane. The Mistress get the slave rock hard and ask him if he wants to cum. The Mistress answer for him and let him know he will not be cumming till they tell him to. Nikki teases the loser with her pussy making him want to cum so bad. The Mistress continues to slow jerk and edge the slaves throbbing cock. The slave is finally allowed to cum. The slave is then fed every drip of his man filth.
Model:
Kimmylee
Studio:
Clubdom.com
Info:
File Name : edgingtothebrinkofinsanity.mp4
File Size : 182.52 MB
Resolution : 640x360
Duration : 00:05:57

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/2f47219513426 (https://tezfiles.com/file/2f47219513426)

Naeite
01-20-2022, 06:09 AM
Clubdom.com- Michelle and Tangent_s Auction Slave 3: Whipped
https://img119.imagetwist.com/th/45049/uock8vabhmll.jpg (https://imagetwist.com/uock8vabhmll/cd_s992_3-8_michellelacy_goddesstangent_whipping.jpg)
https://img202.imagetwist.com/th/45049/o5bcq2zuz5w4.jpg (https://imagetwist.com/o5bcq2zuz5w4/GskKsN.jpg)

Description:
Michelle Lacy and Goddess Tangent are enjoying a smoke. They decide their auction slave needs a good whipping to see how well he holds up. Will he hold up or will he beg for mercy? Michelle grabs her super long whip and delivers some harsh blows. Goddess Tangent decides she wants a turn and tries to break him with her galley whip. Each blow is hard and painful and the slave suffers for his new owners.
Model:
Goddess Tangent, Michelle Lacy
Studio:
Clubdom.com
Info:
File Name : cd_s992_3-8_michellelacy_goddesstangent_whipping.mp4
File Size : 436 MB
Resolution : 1280x720
Duration : 00:09:18

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/e938517fb214a (https://tezfiles.com/file/e938517fb214a)

Naeite
01-20-2022, 06:12 AM
Clubdom.com- They Own Your Balls
https://img119.imagetwist.com/th/45050/y119tezxr100.jpg (https://imagetwist.com/y119tezxr100/cd_s1015_dahilarain_alexisgrace_ballbusting.jpg)
https://img119.imagetwist.com/th/45050/1hl1b241j7ud.jpg (https://imagetwist.com/1hl1b241j7ud/JVywKyST.jpg)

Description:
Goddess Alexis Grace and Mistress Dahlia Rain are giddy and smiling with their hands wrapped around their slave_s balls, squeezing them tightly. They are so happy because they know they are about to administer extreme pain to these pathetic balls that they own, and there is nothing this helpless owned slave can do about it The Mistresses take turns squeezing and poking with their fingernails into his exposed, delicate prunes. That is just the beginning. The Mistresses line up the slave and take turns bashing his balls in with their swift and fierce kicks He can feel that pain shooting through his stomach, crippling him. Again and again, he must endure the torment until the women decide they are finished.
Model:
Alexis Grace, Dahlia Rain
Studio:
Clubdom.com
Info:
File Name : cd_s1015_dahilarain_alexisgrace_ballbusting.mp4
File Size : 366.31 MB
Resolution : 1280x720
Duration : 00:07:45

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/e6ed1e1c846f9 (https://tezfiles.com/file/e6ed1e1c846f9)

Naeite
01-20-2022, 06:25 AM
Clubdom.com- 3 Cocks One Asshole
https://img202.imagetwist.com/th/44670/m9wu4o3pa1w6.jpg (https://imagetwist.com/m9wu4o3pa1w6/3cocksoneasshole.jpg)
https://img165.imagetwist.com/th/44670/l99d6gyq6roo.jpg (https://imagetwist.com/l99d6gyq6roo/3cocksoneasshole.mp4.jpg)

Description:
Mistress Amadahy, Mistress Mia and Mistress Kendra have 3 big black strap-on cocks. The pathetic slave sucks all three cocks before the Mistress_s shove them up his tight man pussy. The Mistress take turns ravaging his defenseless asshole. The slaves screams are muffled by the cocks that are shoved down his throat as he is brutally buttfucked. The Mistress_s let the slave know what a worthless little whore he is as they ram rod his ass. After the slave is turned into nothing but but a little slut the Mistress gloat over him as they stroke there cocks in front of him.
Model:
Goddess Amadahy, Kendra James, Mistress Mia
Studio:
Clubdom.com
Info:
File Name : 3cocksoneasshole.mp4
File Size : 165.35 MB
Resolution : 640x360
Duration : 00:07:30

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/ae418e4147cf5 (https://tezfiles.com/file/ae418e4147cf5)

Naeite
01-20-2022, 06:27 AM
Clubdom.com- Raven Isobel Double StrapOn
https://img119.imagetwist.com/th/45045/xwqpjw25hplj.jpg (https://imagetwist.com/xwqpjw25hplj/s923ravenisobeldoublestrapon.jpg)
https://img202.imagetwist.com/th/45045/won0ldrk6m4k.jpg (https://imagetwist.com/won0ldrk6m4k/WHEbyQTh.jpg)

Description:
Club Dom features famous Mistresses from around the world engaging in slave training, corporal punishment, ball-busting, CBT, strap-on, and more.
Model:
Isobel Devi, Raven Bay
Studio:
Clubdom.com
Info:
File Name : s923ravenisobeldoublestrapon.mp4
File Size : 260.15 MB
Resolution : 1280x720
Duration : 00:04:50

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/445bf415380b4 (https://tezfiles.com/file/445bf415380b4)

Naeite
01-20-2022, 06:30 AM
Clubdom.com- Cherry Kylie Anal Ripping Their Sluts
https://img119.imagetwist.com/th/44829/hnxldiv9kynk.jpg (https://imagetwist.com/hnxldiv9kynk/s764cherrymorgankylieroguedoublestrapon.jpg)
https://img33.imagetwist.com/th/44829/ernucst9qe4m.jpg (https://imagetwist.com/ernucst9qe4m/VJvlTQz.jpg)

Description:
Brat Doms Kylie Rogue and Cherry morgan are all decked out in their school girl outfits, add hot pink and black thigh high boots and gloves, Oh and don_t forget the 13 strap on cocks they are wearing either, They pull some slutty boys from their cage and tell them lube them up good boys because it_s time for some anal ripping fun, Goddess cherry shoves her huge pink cock down slut boys throat as he gags and drips spit everywhere Goddess Kylie takes her bitch slow talking dirty telling him how much he will love his gaping asshole after she is through pounding and ripping it open, the girls fuck these boys hard and stretch out their gaping assholes as far as they will go in every position possible making them beg for every inch of hard cock.
Model:
Cherry Morgan, Kylie Rogue
Studio:
Clubdom.com
Info:
File Name : s764cherrymorgankylieroguedoublestrapon.mp4
File Size : 275.34 MB
Resolution : 1280x720
Duration : 00:05:51

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/e7234212fbc3d (https://tezfiles.com/file/e7234212fbc3d)

Naeite
01-20-2022, 06:33 AM
Clubdom.com- Pounding the Man Pussy
https://img119.imagetwist.com/th/44722/a7babc7fa9f8.jpg (https://imagetwist.com/a7babc7fa9f8/s420_jamie_valentine_harley_dean_ass_pounding.jpg)
https://img119.imagetwist.com/th/44722/gf11m9e6z5hi.jpg (https://imagetwist.com/gf11m9e6z5hi/s420_jamie_valentine_harley_dean_ass_pounding.mp4. jpg)

Description:
Jamie Valentine is the mood for slave ass. She puts her slave on his knees and locks him into a spreader bar. Then she pile drives his man pussy with her thick black cock. Jamie loves pounding his bitches ass. Then she bends him over the sofa and feeds him even more dick.
Model:
Jamie Valentine
Studio:
Clubdom.com
Info:
File Name : s420_jamie_valentine_harley_dean_ass_pounding.mp4
File Size : 252.08 MB
Resolution : 1280x720
Duration : 00:05:21

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/0ed1ac6aec212 (https://tezfiles.com/file/0ed1ac6aec212)

Naeite
01-20-2022, 06:38 AM
Clubdom.com- Hungry For BBC In Ass
https://img119.imagetwist.com/th/44669/0n7pogngp593.jpg (https://imagetwist.com/0n7pogngp593/hungryforbbcinass.jpg)
https://img119.imagetwist.com/th/44669/s0kt1snicrhc.jpg (https://imagetwist.com/s0kt1snicrhc/hungryforbbcinass.mp4.jpg)

Description:
Mistress Ryan and Mistress Elana need to feed this slaves hungry mouth and asshole with big black cock. The Mistress_s start by skull fucking his face. The Mistress_s force there cock deep in his mouth and throat. The Mistress laugh at what a cock hungry whore the slave is. Now its time to feed his man pussy so the Mistress_s bend him over. The Mistress take turns ruthlessly pounding his tight ass hole till it gapes. The Mistress_s see the slaves agony which just encourages them to fuck harder and faster.
Model:
Elena Sin, Jessica Ryan
Studio:
Clubdom.com
Info:
File Name : hungryforbbcinass.mp4
File Size : 152.05 MB
Resolution : 640x360
Duration : 00:06:49

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/d00f4725c5f88 (https://tezfiles.com/file/d00f4725c5f88)

Naeite
01-20-2022, 06:42 AM
Clubdom.com- Owning his Bitch Ass
https://img119.imagetwist.com/th/44722/xyseldesgnsu.jpg (https://imagetwist.com/xyseldesgnsu/1_11_14_strapon.jpg)
https://img202.imagetwist.com/th/44722/w03v3e3ezxib.jpg (https://imagetwist.com/w03v3e3ezxib/1_11_14_strapon.mp4.jpg)

Description:
Kendra James and Jessica Raynes are absolute sadists. They love robbing males of their manhood. They bend two of male bitches over and emasculate them one inch at a time. The ladies pump the _ full of thick black cock. Kendra and Jessica are simply glowing as the fuck their slut_s man pussies. When the ladies have had their fun the put the boys on their knees and demand that they lick the cocks clean.
Model:
Jessica Rayne, Kendra James
Studio:
Clubdom.com
Info:
File Name : 1_11_14 strapon.mp4
File Size : 227.83 MB
Resolution : 1280x720
Duration : 00:07:21

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/18788694eed0e (https://tezfiles.com/file/18788694eed0e)

Naeite
01-20-2022, 06:46 AM
Clubdom.com- Raven Isobel Boot Humping Jerkoff
https://img202.imagetwist.com/th/45043/iaceouwe34ls.jpg (https://imagetwist.com/iaceouwe34ls/s914ravenisobelrickybootjerkoff.jpg)
https://img119.imagetwist.com/th/45043/y81hlokygnkd.jpg (https://imagetwist.com/y81hlokygnkd/euQJVXfq.jpg)

Description:
Mistresses Isobel and Rikki order their slave to jerk off, but they want him to do it only by rubbing his dick up against their boots. Of course rubbing his sensitive flesh against the rough boot exteriors and heels makes it almost impossible to cum due to the pain, even when the Mistresses let him use their spit as lube.

When the Mistresses actually let him jerk off, the slave cums without permission. The furious Mistresses make sure he cleans up his cum not only from their boots but also from the floor as well.
Model:
Raven Bay
Studio:
Clubdom.com
Info:
File Name : s914ravenisobelrickybootjerkoff.mp4
File Size : 311.84 MB
Resolution : 1280x720
Duration : 00:06:37

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/29e0ca045d9d3 (https://tezfiles.com/file/29e0ca045d9d3)

Naeite
01-20-2022, 06:47 AM
Clubdom.com- Tessa_s Cruel Caning
https://img119.imagetwist.com/th/45068/xv11zg5wa8cr.jpg (https://imagetwist.com/xv11zg5wa8cr/cd_s1129_1-3_goddesstessacrane_goddessginger_caning.jpg)
https://img202.imagetwist.com/th/45068/oohni9lgfeqe.jpg (https://imagetwist.com/oohni9lgfeqe/ZWHTiPr.jpg)

Description:
Goddess Tessa Crane drags her new slave to the brick pool patio and her friend Goddess Ginger. Goddess Tessa orders her slave into obedience before creating an artistic masterpiece on his pale white ass with her caning expertise. Goddess Tessa places her property on a bench where she gets ready to cane his ass leaving bright red marks all over the blank white canvas. Goddess Ginger gets in on the action with a couple backhanded swats that make his slave ass jiggle from the impact. The poor slave can_t even sit still during the caning, which make the Goddesses cane his bitch ass even more, and harder.
Model:
Goddess Ginger, Tessa Crane
Studio:
Clubdom.com
Info:
File Name : cd_s1129_1-3_goddesstessacrane_goddessginger_caning.mp4
File Size : 468.47 MB
Resolution : 1280x720
Duration : 00:09:59

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/207fef07ae19c (https://tezfiles.com/file/207fef07ae19c)

Naeite
01-20-2022, 07:01 AM
Clubdom.com- Handymen Get Handled‏ At ClubDom
https://img119.imagetwist.com/th/45070/d7kknte8k6ez.jpg (https://imagetwist.com/d7kknte8k6ez/cd_s569_full_jean_bardot_kylie_rogue.jpg)
https://img202.imagetwist.com/th/45070/dv0yl5si3l3n.jpg (https://imagetwist.com/dv0yl5si3l3n/SZLCibiZ.jpg)

Description:
Mistresses Jean Bardot and Kylie Rouge have hired Lew and Alex, two repairmen to do some odd jobs around the property today. Imagine the shock to the two Doms when one of the repairmen turns out to be a canceling male chauvinist pig. Despite the protests of his partner Alex, Lew can_t shut his mouth and stop letting his male arrogance get him deeper and deeper in trouble. Even worse, after being given direct orders from Miss Bardot not to enter her private dungeon, the brazen idiot marches right in at first opportunity, considering her warnings a joke. Little did these two repairmen know that the joke would be on them. We next find our repairmen in the dungeon, Alex in a dog kennel and loudmouth Lew strapped to a milking bench. Goddess Jean Bardot is furious and decides to remove some of Lew_s testosterone by milking his overactive balls. Both Mistress Kylie and Goddess Jean take turns roughing pulling and milking Lew_s pig stick as he both moans of pleasure and cries in agony. The Goddess_s to not let up for a second, taunting and tormenting the loudmouth caveman as they pull his cum out of his cock and then force him to eat it. Not satisfied, Goddess Jean unleashes fury of kicks to the repairman_s_ balls, leaving him howling like a wounded animal as the Goddess_s move on to repairman Alex. Having been the well behaved one, the Goddesses allow Alex a chance to earn his freedom. If the stud can hold his load and fuck Mistress Kylie and make her cum in under 3 minutes he will be allowed to go free. To drive this point home, Mistress Jean demands Alex deeply inhale the scent of Mistress Kylie womanhood. Driven to please his Masters, Alex fucks the Miss Kylie with all the passion he can muster, finally making her quiver in climax. As Alex withdraws, Goddess Jean realizes that Alex came in his condom as well Furious, the Doms teabag Alex_s slutty mouth with the filled scumbag, then humiliate him by dumping his filth out on his face and in his mouth. Mistress Jean promises he will be punished for an unauthorized orgasm. We return to find both Goddesses amusing themselves punishing Alex by shocking him with a cattle prod. Alex jumps and flails wildly, not knowing where the next jolt of electricity will come from. Both Ladies laugh and laugh at the spectacle before them, noticing that the repairman is paying close attention to their boots. Taking mercy on the sad little slut, Mistress Kylie Rouge and Jean Bardot allow the worm to lock and kiss their boots. As the boots become shiny through worship, both Dommes notice that Alex is quite turned on by worshipping their boots, and demand he becomes a little boot bumper. Alex eagerly humps away like a bunny, slamming his hips and cock into Mistress Kylie boots until he can_t hold back and explodes all over them. Amused, Goddess Jean demands Alex link up his filth. Mistress Kylie mentions how turned on she is, and Goddess Jean remembers that they still have a loudmouth slave to punish. Nothing makes Mistress Kylie cum like the pain and agony of a slave, and Goddess Jean delivers in spades on the rude and arrogant hide of Lew. A brutal caning leaves the loudmouths ass covered in multicolored welts as tears roll down the pig_s face and his screams fill the air. all this pain and suffering has Miss Kylie on the verge of orgasm, so Goddess Jean switches to a whip to amp up the pain even more. Spine chilling screams echo throughout the club do estate as Lew begs and pleads for mercy while Miss Kyle reaches orgasm due to his pain. To finally drive home the point that men should respect women both Doms Don their 10 inch strap on cocks and destroy both repairman asses. Both are flipped upside down and InsideOut but neither can escape nor gain any mercy from the monster cocks if Mistress Jean and Kylie. Once completely Fucked, both boys are ordered to clean their asses off the cocks that just pounded their formally virgin holes. Finally satisfied Goddess Jean tells loudmouth Lew to scram, and he quickly runs for his life off property. However, the cure and respectful Alex is offered a spot in the club do stable. (Full HD Movie)
Model:
Jean Bardot, Kylie Rogue
Studio:
Clubdom.com
Info:
File Name : cd_s569_full_jean_bardot_kylie_rogue.mp4
File Size : 1737.98 MB
Resolution : 1280x720
Duration : 00:36:46

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/dd15a86d25164 (https://tezfiles.com/file/dd15a86d25164)

Naeite
01-20-2022, 07:04 AM
Clubdom.com- Mistress Michelle: Runaway slave_s First Whipping
https://img202.imagetwist.com/th/45045/rnw5dgi7huq1.jpg (https://imagetwist.com/rnw5dgi7huq1/s939michellelacygoddesstangentsuspensionwhip.jpg)
https://img119.imagetwist.com/th/45045/7atpxbn3ex3f.jpg (https://imagetwist.com/7atpxbn3ex3f/TizHiqQ.jpg)

Description:
Mistress Michelle Lacy, keeper of the slaves has found the newest slave has escaped. She drags him back to the estate and has him shackled and awaiting his punishment. She shows him to Goddess Tangent who agrees that he needs to be strung-up and whipped.....upside-down The two Superstar Goddesses of femdom rip into him with their whips while they laugh and taunt him as he cries out apologies. He has never been whipped before and this is a punishment he will never forget. There is nothing like the sting of a whip, especially your first. The ladies mercilessly shred his back and show him that here, femdom is the ONLY WAY and there is absolutely no escape. If he knew how bad it would hurt, he might have never ran. Too late now...
Model:
Michelle Lacy
Studio:
Clubdom.com
Info:
File Name : s939michellelacygoddesstangentsuspensionwhip.mp4
File Size : 405.33 MB
Resolution : 1280x720
Duration : 00:07:28

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/1ec085359f4e8 (https://tezfiles.com/file/1ec085359f4e8)